Leucoraja erinaceus (little skate): 129694103 Help Entry 129694103         CDS       T09122                                  Name (RefSeq) ras-related protein R-Ras2-like   KO K07830   Ras-related protein R-Ras2 Organism leri  Leucoraja erinaceus (little skate) Pathway leri04010   MAPK signaling pathway leri04137   Mitophagy - animal leri04140   Autophagy - animal leri04218   Cellular senescence leri04371   Apelin signaling pathway leri04625   C-type lectin receptor signaling pathway leri04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:leri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129694103    04371 Apelin signaling pathway     129694103  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129694103    04137 Mitophagy - animal     129694103   09143 Cell growth and death    04218 Cellular senescence     129694103   09142 Cell motility    04810 Regulation of actin cytoskeleton     129694103  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129694103  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129694103    04031 GTP-binding proteins [BR:leri04031]     129694103 Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129694103   Exosomal proteins of bladder cancer cells    129694103 GTP-binding proteins [BR:leri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129694103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  129694103 NCBI-ProteinID:  XP_055486804 LinkDB All DBs Position Unknown AA seq 201 aa AA seqDB search MSSKDGALQEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKQCVIDDRAAR LDILDTAGQEEFGAMREQYMRSGEGFLLVFAINDRGSFDEISKFHRQILRVKDRDEFPMI LIGNKADLEHQRQVTKEESDNLAGQLRVTYLEASAKIRLNVDNAFHNLVRAIRKFQELES PPSPQPKPTKRESSGCPCLLL NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaaagacggcgcactccaggagaagtacaagctggtggtcgtgggaggcgga ggggtgggcaaaagtgccctcaccatccagttcatccagtcgtacttcgtctcggactat gacccgacgatcgaggactcctacaccaagcagtgcgtcatagatgatcgggccgcacgg ctagacattttggacacggctggccaagaggagtttggggccatgagggaacagtacatg cggtcgggggaagggttcctcctggtctttgccatcaacgatcggggaagttttgacgag atcagcaagtttcaccggcagattttgcgcgtgaaggacagggacgagtttccgatgatc ctcattgggaacaaggcggatctcgagcaccagagacaggtgacaaaagaggaatctgac aatcttgccgggcagctcagagtcacctacctggaagcatcggcaaaaatccggttgaat gtagacaatgcgtttcacaatctggtgcgggctatacggaagttccaggagctggagagc ccgccgagcccccagcccaagcccaccaagcgggaatccagcggctgcccgtgcctcctc ctgtga

DBGET integrated database retrieval system