Leucoraja erinaceus (little skate): 129694121 Help Entry 129694121         CDS       T09122                                  Name (RefSeq) claudin-15-like isoform X1   KO K06087   claudin Organism leri  Leucoraja erinaceus (little skate) Pathway leri03272   Virion - Hepatitis viruses leri04382   Cornified envelope formation leri04514   Cell adhesion molecules leri04530   Tight junction Brite KEGG Orthology (KO) [BR:leri00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     129694121  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     129694121  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     129694121  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129694121  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:leri03037]     129694121    04147 Exosome [BR:leri04147]     129694121    04515 Cell adhesion molecules [BR:leri04515]     129694121 Cilium and associated proteins [BR:leri03037]  Other cilia and associated proteins   Stereociliary proteins    129694121 Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    129694121   Exosomal proteins of colorectal cancer cells    129694121 Cell adhesion molecules [BR:leri04515]  Immunoglobulin superfamily   L1 family    129694121 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  129694121 NCBI-ProteinID:  XP_055486819 LinkDB All DBs Position Unknown AA seq 171 aa AA seqDB search MSVGDTVSFSLGMVGWVLTGVCLGHHQWKVSTLDGSVITTSTIYENLWMSCASDSTGVYN CRDFLSLFGLSALSAMVPVSWYAFNITQQFYDPLYPGTRFELGPALYIGWAGGTLQLIGG ICLCLACKRATGATAEYAYKYRAPRSSLRPVSRNYPSEVDNSSNYGKNAYV NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgtccgtgggagacacagtgagcttctcgctggggatggtcggctgggtgctgacgggg gtatgtctggggcaccaccagtggaaggtgtccaccctggacggcagtgtgatcactacc tccaccatctacgagaacctatggatgagttgcgccagcgactctaccggcgtctacaac tgcagggatttcctctcgctgtttggtctgtcagcgctgtccgcgatggtcccggtctcc tggtacgcctttaacatcacacagcagttctacgatccactctacccaggaacaaggttt gaactgggaccagcactctacattggctgggcgggtggaacactgcagctgatcggaggg atctgtctctgtcttgcttgtaaaagagccacgggtgcaactgcggagtacgcatacaag taccgagcccccaggtcttccctgcgaccagtgtctcggaactacccctccgaggtggac aactccagtaactacgggaagaatgcgtacgtctga

DBGET integrated database retrieval system