Leucoraja erinaceus (little skate): 129700160 Help Entry 129700160         CDS       T09122                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism leri  Leucoraja erinaceus (little skate) Pathway leri04060   Cytokine-cytokine receptor interaction leri04218   Cellular senescence leri04620   Toll-like receptor signaling pathway leri04621   NOD-like receptor signaling pathway leri04622   RIG-I-like receptor signaling pathway leri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:leri00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129700160  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     129700160  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129700160    04621 NOD-like receptor signaling pathway     129700160    04622 RIG-I-like receptor signaling pathway     129700160  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129700160  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:leri04052]     129700160    00536 Glycosaminoglycan binding proteins [BR:leri00536]     129700160 Cytokines and neuropeptides [BR:leri04052]  Cytokines   Chemokines    129700160 Glycosaminoglycan binding proteins [BR:leri00536]  Heparan sulfate / Heparin   Chemokines    129700160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF6355 Motif Other DBs NCBI-GeneID:  129700160 NCBI-ProteinID:  XP_055496390 LinkDB All DBs Position 1:102770485..102776239 Genome browser AA seq 101 aa AA seqDB search MGRAAGVTILILLLCAVTAQGFPSLGLYGRCHCIRTRSVFIHPKFIRSLKYIPGGAHCEN TEIIITLRHKRKVCVNPDAKWVQAFINANKGQCFMFTRRQL NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgggcagagcagccggtgtgaccatcctcatcctccttctgtgtgccgtcactgcacag ggttttccgagtttaggattatatggacggtgccactgcattagaaccagatctgttttt attcatccaaagttcatccggagcctgaaatatattccaggaggagctcactgtgaaaac acagagataatcatcacactgagacataagagaaaggtgtgcgtgaatcctgatgctaag tgggtgcaggcattcataaatgccaacaaaggtcagtgtttcatgtttaccagacgtcag ctgtga

DBGET integrated database retrieval system