Leucoraja erinaceus (little skate): 129704666 Help Entry 129704666         CDS       T09122                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism leri  Leucoraja erinaceus (little skate) Pathway leri03082   ATP-dependent chromatin remodeling leri04217   Necroptosis Brite KEGG Orthology (KO) [BR:leri00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     129704666  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129704666  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:leri03036]     129704666   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129704666 Chromosome and associated proteins [BR:leri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129704666 Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129704666 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129704666 NCBI-ProteinID:  XP_055503926 LinkDB All DBs Position 16:25276197..25277443 Genome browser AA seq 126 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQTSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaggtaagaccggcggcaaggcacgggctaaagccaagtcccgatcttct cgggctggcttgcagttcccggtcggccgcgtccaccgcctgctgcggaaaggcaactac gccgagcgagtgggagccggggcaccggtgtacttggcagccgtgctcgagtacctgtcg gctgagatcctagaattggccggcaacgcggcccgggacaataagaagaccaggatcatc cctcgtcacctccaacttgccatccggaatgacgaggagctcaacaagctgcttggaggg gtgaccatcgcgcagggaggcgtactgcctaacatccaagccgtgctgttgcccaagaaa acccagacttccaaaaaatga

DBGET integrated database retrieval system