Leucoraja erinaceus (little skate): 129704668 Help Entry 129704668         CDS       T09122                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism leri  Leucoraja erinaceus (little skate) Pathway leri04137   Mitophagy - animal leri04140   Autophagy - animal leri04144   Endocytosis leri04145   Phagosome leri04148   Efferocytosis leri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:leri00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129704668 (rab7a)    04145 Phagosome     129704668 (rab7a)    04140 Autophagy - animal     129704668 (rab7a)    04137 Mitophagy - animal     129704668 (rab7a)    04148 Efferocytosis     129704668 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129704668 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:leri04131]     129704668 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129704668 (rab7a)    04031 GTP-binding proteins [BR:leri04031]     129704668 (rab7a) Membrane trafficking [BR:leri04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129704668 (rab7a) Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129704668 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    129704668 (rab7a)   Exosomal proteins of colorectal cancer cells    129704668 (rab7a)   Exosomal proteins of bladder cancer cells    129704668 (rab7a) GTP-binding proteins [BR:leri04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129704668 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  129704668 NCBI-ProteinID:  XP_055503928 LinkDB All DBs Position 16:complement(25297441..25329014) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccagaaagaaagttttgctgaaagtcatcatcttgggagattcgggggtagga aagacctcactgatgaaccagtatgtcaacaaaaagttcagtaaccaatacaaggcaaca ataggggcagactttctaacaaaggaggtgatggtggacgatcgattggtgacaatgcag atctgggatactgcaggacaagaacgttttcagtcattgggtgtggcgttctacagagga gctgactgctgtgtgctggtctttgatgtaacagcgcccaacacgtttaaaacccttgat agctggagagatgaatttctcattcaggctagtccacgagatccagagaactttccattt gtggtccttggcaataagatagacctggaaaacagacaggtcaccacaaaaagagcacag gcatggtgtcagagcaaaaataatatcccgtactttgaaaccagtgcaaaggaggcaata aatgtggaacaggcttttcaaacaattgcacggaacgcactaaaacaggaaacagaagtg gaactctacaatgaattcccagagccaatcaaactagataagaatgaccgggcaaagact tcagcagaaagttgcagctgctga

DBGET integrated database retrieval system