Leucoraja erinaceus (little skate): 129705671 Help Entry 129705671         CDS       T09122                                  Symbol kras Name (RefSeq) GTPase KRas   KO K02833   GTPase HRas Organism leri  Leucoraja erinaceus (little skate) Pathway leri04010   MAPK signaling pathway leri04012   ErbB signaling pathway leri04068   FoxO signaling pathway leri04137   Mitophagy - animal leri04140   Autophagy - animal leri04144   Endocytosis leri04150   mTOR signaling pathway leri04210   Apoptosis leri04218   Cellular senescence leri04370   VEGF signaling pathway leri04371   Apelin signaling pathway leri04510   Focal adhesion leri04540   Gap junction leri04625   C-type lectin receptor signaling pathway leri04810   Regulation of actin cytoskeleton leri04910   Insulin signaling pathway leri04912   GnRH signaling pathway leri04916   Melanogenesis leri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:leri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129705671 (kras)    04012 ErbB signaling pathway     129705671 (kras)    04370 VEGF signaling pathway     129705671 (kras)    04371 Apelin signaling pathway     129705671 (kras)    04068 FoxO signaling pathway     129705671 (kras)    04150 mTOR signaling pathway     129705671 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129705671 (kras)    04140 Autophagy - animal     129705671 (kras)    04137 Mitophagy - animal     129705671 (kras)   09143 Cell growth and death    04210 Apoptosis     129705671 (kras)    04218 Cellular senescence     129705671 (kras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     129705671 (kras)    04540 Gap junction     129705671 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129705671 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129705671 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     129705671 (kras)    04912 GnRH signaling pathway     129705671 (kras)    04916 Melanogenesis     129705671 (kras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129705671 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:leri04131]     129705671 (kras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129705671 (kras)    04031 GTP-binding proteins [BR:leri04031]     129705671 (kras) Membrane trafficking [BR:leri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129705671 (kras)  Endocytosis   Macropinocytosis    Ras GTPases     129705671 (kras) Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    129705671 (kras)   Exosomal proteins of colorectal cancer cells    129705671 (kras) GTP-binding proteins [BR:leri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129705671 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  129705671 NCBI-ProteinID:  XP_055505334 LinkDB All DBs Position 18:complement(12911225..12934367) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREISQHKVRKSNPPDESGQD CNNCKCVLL NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggttggagcaggaggtgtcggcaagagcgcattgacc atccaactcatacagaaccactttgtggatgaatacgaccccacgatcgaggactcgtac aggaagcaggtggtcatcgacggggagacgtgtttgctggacatcctcgacacggccggc caagaggagtacagcgccatgcgagaccagtacatgcgcaccggggagggtttcctgtgt gtcttcgccatcaataataccaagtcgtttgaagacatccaccagtacagggagcagatc aaacgggtgaaggattccgatgacgttccgatggttttagtggggaacaagtgtgacctt ccgtcccggactgtggagacacggcaagcgcaggatctggcccggagctacggcattcct tacatcgaaacctcggccaaaaccaggcagggggtggaggacgccttctacaccttggtc cgagagataagccaacacaaagtgaggaagtcgaacccgccggatgagagtggccaggac tgtaacaactgtaaatgtgtcctcttgtga

DBGET integrated database retrieval system