Leucoraja erinacea (little skate): 129707227 Help Entry 129707227         CDS       T09122                                  Symbol bcl2l1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism leri  Leucoraja erinacea (little skate) Pathway leri04115   p53 signaling pathway leri04137   Mitophagy - animal leri04140   Autophagy - animal leri04210   Apoptosis leri04621   NOD-like receptor signaling pathway leri05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:leri00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129707227 (bcl2l1)    04137 Mitophagy - animal     129707227 (bcl2l1)   09143 Cell growth and death    04210 Apoptosis     129707227 (bcl2l1)    04115 p53 signaling pathway     129707227 (bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129707227 (bcl2l1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     129707227 (bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:leri01009]     129707227 (bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:leri03036]     129707227 (bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:leri02000]     129707227 (bcl2l1) Protein phosphatases and associated proteins [BR:leri01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      129707227 (bcl2l1) Chromosome and associated proteins [BR:leri03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     129707227 (bcl2l1) Transporters [BR:leri02000]  Other transporters   Pores ion channels [TC:1]    129707227 (bcl2l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 HTH_Tnp_ISL3 Motif Other DBs NCBI-GeneID:  129707227 NCBI-ProteinID:  XP_055508061 LinkDB All DBs Position 21:9319288..9343042 Genome browser AA seq 202 aa AA seqDB search MCSSSELVIHFLRYRLQQRGHSWSRLCEQDGAAERGLNSDVAADFNDRHEAERTCQALRE AAEEFELRYRRAFSDLSAQLRVTPDTAYRRFEQVVGELFRDGVNWGRLVAFFCFGAALSV ESAEKEMGTLVPRIAHWMSTYLESNLEPWIQQHGGWNAFVVLYGNNAAARNRELQEKAMK WFVALMALGATLAVAAYVARRR NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgtgcagcagcagtgagctcgtcatccacttcctgcgctacagactgcagcagcggggc cacagttggagccggctgtgtgaacaggatggcgcggccgaacggggactcaactctgat gtcgccgctgatttcaatgacaggcacgaggccgaacgcacctgccaggccctgcgagag gccgccgaggaattcgagctgcgctaccgccgggccttcagcgatctgtccgctcagctg cgcgtcaccccggacactgcttaccggcgtttcgagcaggttgtgggcgagctgttccgc gacggcgtcaactggggccggttggtcgcattcttctgcttcggggcggcgctgagtgtg gagagcgccgagaaggagatgggtacactggtgccacggatcgcccattggatgagcacc tacctggaaagtaatctggagccgtggatccaacaacacggcggctggaatgcctttgtg gtgctatatgggaataatgctgctgcacgtaaccgtgagttacaggagaaggccatgaaa tggtttgtggcactaatggctttgggtgcaacactagccgttgctgcgtatgtggcccgg agaaggtaa

DBGET integrated database retrieval system