Leucoraja erinaceus (little skate): 129708834 Help Entry 129708834         CDS       T09122                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism leri  Leucoraja erinaceus (little skate) Pathway leri04010   MAPK signaling pathway leri04012   ErbB signaling pathway leri04068   FoxO signaling pathway leri04137   Mitophagy - animal leri04140   Autophagy - animal leri04150   mTOR signaling pathway leri04210   Apoptosis leri04218   Cellular senescence leri04370   VEGF signaling pathway leri04371   Apelin signaling pathway leri04540   Gap junction leri04625   C-type lectin receptor signaling pathway leri04810   Regulation of actin cytoskeleton leri04910   Insulin signaling pathway leri04912   GnRH signaling pathway leri04916   Melanogenesis Brite KEGG Orthology (KO) [BR:leri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129708834 (nras)    04012 ErbB signaling pathway     129708834 (nras)    04370 VEGF signaling pathway     129708834 (nras)    04371 Apelin signaling pathway     129708834 (nras)    04068 FoxO signaling pathway     129708834 (nras)    04150 mTOR signaling pathway     129708834 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129708834 (nras)    04137 Mitophagy - animal     129708834 (nras)   09143 Cell growth and death    04210 Apoptosis     129708834 (nras)    04218 Cellular senescence     129708834 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     129708834 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129708834 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129708834 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     129708834 (nras)    04912 GnRH signaling pathway     129708834 (nras)    04916 Melanogenesis     129708834 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:leri04131]     129708834 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129708834 (nras)    04031 GTP-binding proteins [BR:leri04031]     129708834 (nras) Membrane trafficking [BR:leri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129708834 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     129708834 (nras) Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129708834 (nras)   Exosomal proteins of other body fluids (saliva and urine)    129708834 (nras)   Exosomal proteins of breast cancer cells    129708834 (nras)   Exosomal proteins of colorectal cancer cells    129708834 (nras) GTP-binding proteins [BR:leri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129708834 (nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N IL23 Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  129708834 NCBI-ProteinID:  XP_055510826 LinkDB All DBs Position 24:25261567..25287564 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNHKSFADVHLYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRTIKLNSQDDRNQG CLGLKCIIM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaacttgtcgtggtaggagctggtggtgtgggaaagagtgccttaacg atccaattgattcagaaccactttgtggatgaatatgatccaacgatagaggactcctac aggaagcaggtagtgattgatggtgaaacatgtttattagacattctggacacagcaggt caagaagagtatagtgctatgagagatcagtacatgaggacaggagaagggttcctctgc gtctttgccataaacaatcataaatcatttgcagatgttcatttgtacagagaacaaatt aaaagagtaaaggattctgaagatgtccccatggtcttggtgggaaacaaatgtgattta ccttcacggactgtggacacaaaacaagcacaggaactggctaggagttatggaatacct ttcatagagacctcagcaaaaacaagacagggagttgaagatgcattttacacactggta cgagagattcggcaatacagaacgataaaactcaacagtcaagacgatagaaatcaaggt tgcttggggttaaaatgcatcattatgtaa

DBGET integrated database retrieval system