Leucoraja erinaceus (little skate): 129711083 Help Entry 129711083         CDS       T09122                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism leri  Leucoraja erinaceus (little skate) Pathway leri04382   Cornified envelope formation leri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:leri00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129711083  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129711083  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129711083 Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of microglial cells    129711083 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 BLI1 EF-hand_11 Motif Other DBs NCBI-GeneID:  129711083 NCBI-ProteinID:  XP_055514442 LinkDB All DBs Position 29:6718779..6723240 Genome browser AA seq 103 aa AA seqDB search MANLSRIEVSMQNLIDVFYEYTTADKYTLNKPEMRKLVEVELNQLTKNKKNVEYFDQLFK DLDFDRDGEVNFEEFVSFIAGIMYSCNELYLQKKQQMAKGCKK NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcaaatctatcccggattgaggtgtcgatgcagaacctgattgatgttttctacgag tacactacggccgacaagtacactttgaacaagcctgagatgagaaaactggtggaggtt gaactgaaccaactcaccaagaataaaaaaaacgttgaatactttgaccagctatttaaa gatttggattttgacagagacggagaagtgaactttgaagagttcgtgtcatttattgca ggaatcatgtactcctgcaatgaactgtatctgcagaagaagcaacaaatggcaaagggc tgcaaaaagtaa

DBGET integrated database retrieval system