Leucoraja erinaceus (little skate): 129712533 Help Entry 129712533         CDS       T09122                                  Name (RefSeq) histone H4-like   KO K11253   histone H3 Organism leri  Leucoraja erinaceus (little skate) Brite KEGG Orthology (KO) [BR:leri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:leri03036]     129712533   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129712533 Chromosome and associated proteins [BR:leri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129712533 Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129712533 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S Bromo_TP TFIID-31kDa CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129712533 NCBI-ProteinID:  XP_055516988 LinkDB All DBs Position 33:complement(1420142..1420567) Genome browser AA seq 103 aa AA seqDB search MAVRGHGERRLGERGARRHSKDLCDNLRGITKPAIRRLARRGGVKRISGPTYQEERGVLQ VFLENVIRDAMTYTEHADRQTVAALDVVHALKRQGRALYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcagtgagagggcatggagagaggagactgggcgagcgtggcgcaaggcggcacagt aaagacctctgtgacaaccttcgaggcatcaccaaacctgccattcgccgtttggctcga cgaggtggggtcaagcgtatttctggcccaacctaccaggaagagcgtggggttttgcag gttttccttgagaatgtcatccgggatgcaatgacctacacagaacatgcggatcgccag acagtggcagctctagacgtggtgcatgcactgaaacgccaggggcgcgccttgtatggg ttcgggggttga

DBGET integrated database retrieval system