Leucoraja erinaceus (little skate): 129713425 Help Entry 129713425         CDS       T09122                                  Name (RefSeq) histone H2A.V isoform X1   KO K11251   histone H2A Organism leri  Leucoraja erinaceus (little skate) Pathway leri03082   ATP-dependent chromatin remodeling leri04217   Necroptosis Brite KEGG Orthology (KO) [BR:leri00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     129713425  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129713425  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:leri03036]     129713425   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:leri04147]     129713425 Chromosome and associated proteins [BR:leri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129713425 Exosome [BR:leri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129713425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129713425 NCBI-ProteinID:  XP_055518445 LinkDB All DBs Position 35:15288039..15302573 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcgggaaagctgggaaggattcgggaaaggctaaagctaaagcagtttcccgc tctcaaagagcaggattacagtttcctgtaggtcgtattcataggcatttgaagactcgt actaccagccatggacgagtgggtgctacagctgccgtgtacagtgcagcaatcttggag tatctcactgctgaggtgttggagttggcaggaaatgcatcgaaggatctgaaagtaaag cgcattacgccacgtcacttgcagttggccatccgaggtgatgaagagctggattcactg atcaaggcaaccattgctggtggtggtgtgatccctcacattcacaagtctctgattgga aagaagggccagcagaaaactgcataa

DBGET integrated database retrieval system