Leucoraja erinaceus (little skate): 129715772 Help Entry 129715772         CDS       T09122                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism leri  Leucoraja erinaceus (little skate) Pathway leri04068   FoxO signaling pathway leri04136   Autophagy - other leri04140   Autophagy - animal leri04621   NOD-like receptor signaling pathway leri04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:leri00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     129715772 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129715772 (atg12)    04136 Autophagy - other     129715772 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129715772 (atg12)    04622 RIG-I-like receptor signaling pathway     129715772 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:leri04131]     129715772 (atg12)    04121 Ubiquitin system [BR:leri04121]     129715772 (atg12)    03029 Mitochondrial biogenesis [BR:leri03029]     129715772 (atg12) Membrane trafficking [BR:leri04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     129715772 (atg12) Ubiquitin system [BR:leri04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    129715772 (atg12) Mitochondrial biogenesis [BR:leri03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     129715772 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  129715772 NCBI-ProteinID:  XP_055521598 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MAETEEPQRRKIDVLLKAVGDTPIMKQKKWTVERSRTIQALGLFVTKFLKLEAGEQLFIY VNQSFAPSPEQDVGTLFECFGSDNKLVLHYCKSQAWG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcggagacggaggagccgcagcgacggaaaattgatgttctcctgaaggcggtggga gatacgccgatcatgaagcagaagaaatggacggtggagagatcgcggacaatccaggcg ctcgggctcttcgtgacaaagttcctcaagttggaggccggagagcaactgtttatttac gtgaatcagtcttttgccccctctcccgagcaggacgtcggaacactattcgagtgcttt gggagtgacaataagttggtgctccactactgcaaatcacaagcgtgggggtga

DBGET integrated database retrieval system