KEGG   Leucobacter muris: Leucomu_03750
Entry
Leucomu_03750     CDS       T05802                                 
Name
(GenBank) 4Fe-4S dicluster domain-containing protein
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
leu  Leucobacter muris
Pathway
leu00630  Glyoxylate and dicarboxylate metabolism
leu00680  Methane metabolism
leu01100  Metabolic pathways
leu01120  Microbial metabolism in diverse environments
leu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:leu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Leucomu_03750
  09102 Energy metabolism
   00680 Methane metabolism
    Leucomu_03750
SSDB
Motif
Pfam: Fer4_11 Fer4_7 Fer4_9 Fer4_6 Fer4_2 Fer4_10 Fer4 Fer4_8 Fer4_16 Fer4_17 Fer4_4 Fer4_3 Fer4_21 Fer4_15
Other DBs
NCBI-ProteinID: QAB17153
UniProt: A0ABX5QDK4
LinkDB
Position
805660..806667
AA seq 335 aa
MSRLTESEHAAHHEHVHPRKGFFTDTSICIGCKACEVACKEWNRNPADSDWQLSDSSYDN
SEGLGADTWRHVAFIEQGQERIEEARESGRRLVSLGMPTVRPATGAGADGSADLSGADTA
PPDTPDFRWLMSSDVCKHCTNAGCLDVCPTGALFRTEFGTVVVQEDICNGCGTCVAGCPF
GVIERRSDGIAVPKTNRDFVPGEQAPTRNAGVAQKCTLCYDRLTDDQTPACAQACPTTSI
KFGSREELAKIARARVRELHKQGLTEARLYGANERDGVGGTGSIFLLLDEPEVYGLPPDP
QVATKDLPRMYKRAGLAALGMIGAVALAFLTGGRR
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagcaggctcacggagtccgagcacgccgcccaccacgagcacgtgcacccccgcaag
ggcttcttcacggacacctccatctgcatcggctgcaaggcctgcgaggtcgcctgcaag
gagtggaaccgcaaccccgccgactccgactggcagctctccgactcgtcgtacgacaac
tccgaggggctcggcgccgacacctggcgccacgtcgcgttcatcgagcaggggcaggag
cggatcgaggaggcgcgcgagagcgggcgccggctcgtgagcctcggaatgcccacggtg
cgccccgcgaccggcgcaggggccgacggctccgcagacctgtcgggcgccgacaccgcc
ccgcccgacacccccgacttccggtggctcatgtcgtcggacgtgtgcaagcactgcacc
aacgccggctgcctcgacgtctgccccacgggcgcgctcttccgcaccgagttcggcacg
gtcgtggtgcaggaggatatctgcaacggctgcggcacctgcgtggccgggtgccctttc
ggcgtgatcgagcggcgcagcgacgggatcgccgtgcccaagacgaaccgcgacttcgtg
cccggcgagcaggcgcccacccgcaacgcgggcgttgctcagaagtgcacgctctgctac
gaccgcctcaccgatgatcagacgcccgcctgcgcgcaggcctgccccaccacgtcgatc
aagttcggcagtcgcgaggagctcgcgaagatcgctcgggcccgcgtgcgcgaactgcac
aagcagggcctcaccgaggcgcggctctacggcgcgaacgagcgcgacggcgtgggcggc
acggggtcgatcttcctgctgctcgacgagcccgaggtgtacgggctgcccccggacccg
caggtcgcgacgaaggatctgccccgcatgtacaagcgcgccggtctcgccgcgctcggc
atgatcggcgcggtcgcgctcgcgttcctcaccggagggcgtcgatga

DBGET integrated database retrieval system