KEGG   Leisingera sp. NJS201: ETW23_18320
Entry
ETW23_18320       CDS       T08375                                 
Name
(GenBank) elongation factor G
  KO
K02355  elongation factor G
Organism
lev  Leisingera sp. NJS201
Brite
KEGG Orthology (KO) [BR:lev00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lev03012]
    ETW23_18320
   03029 Mitochondrial biogenesis [BR:lev03029]
    ETW23_18320
Translation factors [BR:lev03012]
 Eukaryotic type
  Elongation factors
   ETW23_18320
 Prokaryotic type
   ETW23_18320
Mitochondrial biogenesis [BR:lev03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ETW23_18320
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    ETW23_18320
SSDB
Motif
Pfam: EFG_IV EFG_C GTP_EFTU EFG_III AAA_16 MMR_HSR1 AAA_29 ABC_tran
Other DBs
NCBI-ProteinID: QBR37784
LinkDB
Position
complement(3708812..3710719)
AA seq 635 aa
MRVFTILGPSQSGKSTLATALANLDSAAGKRQEVAGVAALQPFSFMGEDWAAIDIAGGAD
NLAQAGPALAASDAAVLCVPADAGAAVLSAPYLRKLEEAGIPAFLFVNRMDQAADRVAEI
VAALQAYCSHNIILRQVPIREDGQVVGAVDLISERAWQYQEGKPSALIELPVAMYAREQE
ARTELLEALADFDDTLLEELIEDQKVMPEEVYDVATKVLQHNDLVPALMGSAEHKNGILR
LMKSLRHEAPDVGVALERLSQDGAVVAVGCMADLVKHLGKTVMVRALDIGMGNGAPVGGA
ALGSLTGIGGAVNNAFQAGDIGQAVKSDHLNLGFAYGPEGAAPLPDWAQPRPSTFRRVIT
PLNERDDARLSGALERLAEIDPALVVGQDEASGHLLLNLQGPLHMRRIKQALKDEFGVEV
EEGQVPPALRETISKSVQIQYRHRKQSGGAGQFADVVIKVKPLPRGSGFVFEETVKGGAV
PKNYIPSVEAGAREALAQGLNGHPVVDVCVTLKDGKHHSVDSSDYAFRTAGKNAVREALS
EAGAVLLQPIMRVHIHVPSVFTGGLVPVVSGMKGQILGFEAEDGVAGWDVFETLLPMSAQ
DNLCNTLASATRGTGWFSTDFDHYEEARRADFAEA
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgcgcgttttcactattctgggaccgtcgcagtccggcaaatcaacgctggccacggcg
ctggccaatctggacagcgctgccggcaagcggcaggaggttgcaggcgttgccgctttg
cagcctttttcattcatgggcgaggactgggccgcaatcgacatcgcgggcggggccgac
aatctggcgcaggcggggcctgcactggcggccagcgacgcggccgtcctttgcgtgccg
gctgatgccggggctgcggtgctaagcgcgccgtatctgcgcaagctggaggaggcgggc
atccccgcctttctttttgtcaaccgcatggaccaggcagcggaccgggtggcagagatc
gttgccgcgcttcaggcctattgcagccacaacatcattctgcggcaggtgccgatccgc
gaggatggccaggttgtgggcgctgtggatctgatttccgaacgcgcctggcagtatcag
gagggtaagccttcggcgctgattgagctgccggtggcaatgtatgcgcgcgagcaggag
gcccgcaccgagctgctggaagcgctggcggattttgacgacacgctgctggaagagttg
atcgaggatcagaaggtgatgccggaagaggtctatgatgtggcgaccaaggtgctgcag
cataacgacctggttccggcactgatggggtcggctgagcataagaatggcatcctgcgg
ctgatgaagtccttgcggcacgaggcgccggatgtgggcgtcgcactggagcggctgtcg
caggacggcgcggtggtggccgtcggctgcatggcggatctggtcaaacatcttggcaag
acggtgatggtacgcgcgctggacataggcatgggcaatggcgcccctgtcggcggcgcg
gcactggggtcgctgacagggatcggcggcgccgtgaacaacgcgtttcaggcaggagac
attgggcaggcggttaaatcggatcatttgaacctgggttttgcctatgggccggaaggg
gcggcgccgttgccggattgggcgcagccgcggccttcgacattccggcgggtgatcact
ccgttgaatgagcgcgacgatgcgcggctgtcgggcgcgctggaacggctggcggagatc
gacccggcgctggtggtggggcaggatgaggccagcggccatctgctgctgaacctgcag
gggccgctgcacatgcgacgcatcaagcaggctttgaaagacgagttcggcgtcgaggtg
gaggaggggcaggtgcctccggcgctgcgcgagaccatcagcaagagcgtgcagatccaa
taccgacaccgcaagcagtccggcggcgcgggtcagtttgccgatgtggtgatcaaggtg
aagccgttgccgcgcggcagcggctttgtgttcgaggaaacagtgaagggcggcgcggtg
cccaagaactacatcccctcggtcgaggccggcgcgcgcgaagcgctggcgcaggggctt
aacggccatccggtagtggatgtctgcgtgacgctgaaggacggcaagcatcactcggtc
gacagttccgactatgccttccgcaccgcgggcaagaacgcggttcgggaggcgctgtct
gaggccggcgcggtgctgctgcagccgatcatgcgggtgcatatccatgtgccgtccgtc
ttcaccggcgggctggtgccggtggtgagcggcatgaaggggcagattctggggttcgag
gctgaggacggcgtggccggctgggacgtgttcgaaaccctgctgccaatgtcggcgcag
gataatctgtgcaacacgctggccagtgccacccgcggtaccggctggttcagcactgat
ttcgaccactatgaagaggcgcggcgggcggatttcgccgaggcctag

DBGET integrated database retrieval system