Lelliottia sp. WB101: DAI21_18560 Help Entry DAI21_18560       CDS       T05398                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism lew  Lelliottia sp. WB101 Brite KEGG Orthology (KO) [BR:lew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lew03400]     DAI21_18560 DNA repair and recombination proteins [BR:lew03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     DAI21_18560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI KH_PARP14_2 Motif Other DBs NCBI-ProteinID:  AVY99513 UniProt:  A0AAD0ILT7 LinkDB All DBs Position 3820191..3820436 Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTTLPAGALDALAGELSRRINSTFPDQEGAVTVRYASANNLSVLGGAKEDK DRISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcgaagtgactatcgccaaaacaaccactttgcctgctggcgcgctggatgcg ctggccggagaactctcccgtcgcatcaacagcacgttccccgatcaggaaggggctgtc accgtccgttacgcctccgcgaacaatctttccgtcctcggtggggcaaaagaggataaa gatcgcattagcgaaatcctgcaagaaacctgggaaagcgccgacgactggttcatcacc gattaa

DBGET integrated database retrieval system