Leclercia sp. W6: DVA43_22265 Help Entry DVA43_22265       CDS       T08905                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ley  Leclercia sp. W6 Pathway ley01100   Metabolic pathways ley01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ley00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DVA43_22265    00074 Mycolic acid biosynthesis     DVA43_22265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DVA43_22265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXF62628 UniProt:  A0AAD0LSU4 LinkDB All DBs Position 4523156..4523428 Genome browser AA seq 90 aa AA seqDB search MNDDIEQRKKVLLTIKTEIIQRLNIQREVSQIDDDTALFGNGLKLDSVDATEIVVLLDKV FDIKVSESDDPSYMRSINSLATFVIQKQNA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaatgacgatattgaacagcgcaaaaaggttttgctgacgattaaaaccgaaatcatt cagcgactgaatatccaacgcgaagtatcacagattgatgatgacactgcgctgtttggc aatggcctgaaactggattccgtggatgcgacagagattgttgtgttgttggataaagtt ttcgatattaaggtgagcgaaagcgatgacccatcttatatgcgaagcattaatagcctt gcaacatttgtcatccagaagcaaaacgcttaa

DBGET integrated database retrieval system