Lysobacter enzymogenes C3: GLE_0641 Help Entry GLE_0641          CDS       T04371                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism lez  Lysobacter enzymogenes C3 Pathway lez00190   Oxidative phosphorylation lez01100   Metabolic pathways lez02020   Two-component system Module lez_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:lez00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GLE_0641 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     GLE_0641 (ybgT) Enzymes [BR:lez01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      GLE_0641 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Cyt_bd_oxida_II Motif Other DBs NCBI-ProteinID:  ALN55999 UniProt:  A0A0S2DC07 LinkDB All DBs Position 710063..710188 Genome browser AA seq 41 aa AA seqDB search MWYFAWILGLALACSFGVLNAMWFEMREDDDQSRAQARRGR NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcctggatcctcggcctcgccctggcctgcagcttcggcgtgctcaat gcgatgtggttcgagatgcgcgaggacgacgaccagtcgcgcgcgcaggcgcggcggggc cgttga

DBGET integrated database retrieval system