KEGG   Laceyella sacchari: C1X05_10845
Entry
C1X05_10845       CDS       T05304                                 
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
lfb  Laceyella sacchari
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    C1X05_10845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lfb03019]
    C1X05_10845
   03009 Ribosome biogenesis [BR:lfb03009]
    C1X05_10845
   03036 Chromosome and associated proteins [BR:lfb03036]
    C1X05_10845
Enzymes [BR:lfb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     C1X05_10845
Messenger RNA biogenesis [BR:lfb03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     C1X05_10845
Ribosome biogenesis [BR:lfb03009]
 Eukaryotic type
  90S particles
   RNase
    C1X05_10845
 Prokaryotic type
  rRNA processing factors
   C1X05_10845
Chromosome and associated proteins [BR:lfb03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     C1X05_10845
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DND1_DSRM DSRM_2 PRD
Other DBs
NCBI-ProteinID: AUS09268
UniProt: A0ABY5TZ02
LinkDB
Position
complement(2229285..2229977)
AA seq 230 aa
MMDLSELERSIGLTLKNKKLFQQAFTHTSFAHERKNSGKFPDNERLEFLGDAVLELAVSE
YLFHRYPQMSEGELTRTRARVVCEASLASFAKELDFGRFVRLGKGEEMTGGRTRPSLLAD
VFEAFIGALFLDQGLDEVRRFLTRLVFPKINDEWLANMLDAKSQLQELVQQERLGALEYR
IVDMQGPAHDRHFVAEVYLEDRCLGQGAGRSKKEAEQQAALIALKTWKAR
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatggatttatctgagttggaacggtccatcggcttgaccttgaaaaacaaaaaattg
ttccaacaagcttttacccacacttcatttgcccatgaacggaaaaacagcgggaagttc
ccagacaatgagcgattggagttcttgggagacgcggtgcttgaactggcagtgtcggaa
tacttgtttcaccgttatccgcagatgagcgaaggtgaattgacacgcacacgggcacgt
gtggtgtgtgaagcatcccttgcttcttttgccaaagagcttgattttgggcgctttgtg
cgattgggaaaaggagaggagatgacgggaggccgcacccgtccttccctcttagccgat
gtgtttgaagcttttatcggagccttgtttttggatcagggcttggatgaggtgcggcgg
tttttgaccagattggtctttccgaaaatcaatgatgaatggctggccaacatgttggac
gccaaaagccagttgcaagagctggttcaacaagagagattgggtgccttggaatatcgg
attgtagatatgcaaggccctgcgcatgatcgccactttgtggctgaagtgtatcttgaa
gaccgatgcttgggacaaggcgcgggtcgttccaaaaaagaagcagaacaacaagcggcg
ctgatcgcccttaaaacttggaaagcaagataa

DBGET integrated database retrieval system