Ligilactobacillus faecis: QFX10_09285 Help Entry QFX10_09285       CDS       T08999                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lfd  Ligilactobacillus faecis Pathway lfd01100   Metabolic pathways lfd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lfd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QFX10_09285 (acpP)    00074 Mycolic acid biosynthesis     QFX10_09285 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QFX10_09285 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 MPN337 Guanylate_cyc Nup192 Motif Other DBs NCBI-ProteinID:  WGN89224 LinkDB All DBs Position complement(2032602..2032844) Genome browser AA seq 80 aa AA seqDB search MNENEILEKITAIIEERFDVTADAVQKETSFKDDLDADSIELVEFVLELEDTFGAEISDE DAEKIETVGDAVDYIAAHQA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaatgaaaatgaaattttagaaaagatcacagcgatcatcgaagaacgttttgacgtt actgctgatgcagtccaaaaagaaacaagttttaaagatgacttagatgcagactcgatc gaattggtcgaatttgtcctcgaactagaagatacatttggagctgagatctctgatgaa gatgctgaaaagatcgaaaccgtaggcgatgcagttgactacatcgcagctcatcaagct taa

DBGET integrated database retrieval system