Leptospirillum ferriphilum ML-04: LFML04_1276
Help
Entry
LFML04_1276 CDS
T02319
Name
(GenBank) putative permease, YjgP/YjgQ family
KO
K11720
lipopolysaccharide export system permease protein
Organism
lfi
Leptospirillum ferriphilum ML-04
Pathway
lfi02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
lfi00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
LFML04_1276
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
lfi02000
]
LFML04_1276
Transporters [BR:
lfi02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
LFML04_1276
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Wzy_C_2
Motif
Other DBs
NCBI-ProteinID:
AFS53502
UniProt:
J9ZCM7
LinkDB
All DBs
Position
complement(1210886..1211974)
Genome browser
AA seq
362 aa
AA seq
DB search
MRILTRYIASELFKIFLLCFISLEAIYGVIDSVEKIKDFLSHHAALPLIGQYFFYRSIEV
SFRVLPMSGLLATLLTLGILSKNHELTAIRAAGISLVKATKPFLALGVLISLISIAMNYQ
LVPYAYQMTDYIKDVRIDQGKSGNVTFELNNVWFRHGNQDIYGARTIRDGGNELDKVVLY
HLDRTFHLSWQVDAKTLRYHQGLWSFQDGHLTRFLPDGSLKIESFQKMDTTLTRRPVDFT
YEKTRMTHLSYPELDRYIALLEKSHLPREKYEVTRDAMIAFPIAAFLMVLMAIPFGIREG
RQVGIAKGFGISLLLSMSYWTIYSLGLALGKGGVLLPWISAWFANMIVFFVSISLFLLLN
RS
NT seq
1089 nt
NT seq
+upstream
nt +downstream
nt
atgaggatcctgacgcggtatattgcctccgaacttttcaagatctttcttctgtgcttt
atttccctggaagcaatctatggcgttatcgattcggttgaaaagatcaaggactttctc
agtcaccatgcggcgctccctctgattggccaatactttttctatcgctccatcgaggtc
agcttccgcgtcctgcccatgtccggactgctcgcaactctcctgacacttggcatcctg
tccaaaaaccacgaactgacggccatccgggctgcggggatcagccttgtcaaggcaacc
aaaccgtttctggccctcggggttctgatttccctgatttccatcgcaatgaactatcag
ctcgttccctatgcctaccagatgacggactatatcaaggacgtccgtattgaccagggc
aaaagcggcaacgtgaccttcgaactcaacaatgtctggtttcgccatgggaatcaggac
atttatggtgcccggaccatccgggacggcgggaatgagctggacaaagtcgtcctgtat
catttggacagaaccttccatctgagctggcaggtcgatgccaaaacccttcgttaccat
caggggctctggtcttttcaggacgggcacctcacgcgttttctcccggatggctctctc
aaaatcgagtcatttcagaaaatggacaccaccctgactcgacggccggtggatttcacc
tacgaaaaaacccggatgacgcacctttcctatccggaactggaccgttacatcgctctg
cttgaaaaaagccatcttccccgcgaaaaatatgaggtcacccgcgatgcgatgatcgcg
ttcccgattgccgcctttctcatggttctgatggccatccctttcggtatccgggagggg
cggcaagtgggaattgccaaaggattcgggatcagtctgctgttgtccatgtcctactgg
accatttattctctcggactggccctggggaaaggaggcgttctcttgccctggatcagc
gcctggtttgcgaacatgattgtttttttcgtcagcatttcactttttttactcttgaac
cgttcctga
DBGET
integrated database retrieval system