Luteibacter flocculans: IM816_11205 Help Entry IM816_11205       CDS       T08863                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lfl  Luteibacter flocculans Pathway lfl01100   Metabolic pathways lfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IM816_11205 (acpP)    00074 Mycolic acid biosynthesis     IM816_11205 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IM816_11205 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  URL57218 LinkDB All DBs Position complement(2647340..2647579) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTTASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgtcgtggaacagctgggcgtcaaggaa gaggaagtcaccaccaccgcgtcgttcgttgacgatctgggcgccgattcgctggacacg gtcgagctcgtgatggcgctcgaggaagagttcgagtgcgagatcccggacgaggaagcc gagaagatcacgacggtccagcaggcgatcgattacgtcaaggctcacgtcaaggcctga

DBGET integrated database retrieval system