Luteibacter flocculans: IM816_17445 Help Entry IM816_17445       CDS       T08863                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lfl  Luteibacter flocculans Pathway lfl01100   Metabolic pathways lfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IM816_17445    00074 Mycolic acid biosynthesis     IM816_17445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IM816_17445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Transglut_i_TM Motif Other DBs NCBI-ProteinID:  URL58350 LinkDB All DBs Position complement(4026014..4026286) Genome browser AA seq 90 aa AA seqDB search MATQTAEQQELAELIVKSLNLESTKPADIDPDAPLFGGDLGLDSIDALEIALAVSKHYGF QLKSDNENNRAIFTSLRTLSEHIEQHRAAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcaacgcagaccgcagaacagcaagaactggccgaactcatcgtcaagagcctcaac ctcgaatcgacgaagccggccgacatcgacccggatgctccgctgttcggcggagacctg gggctcgattccatcgacgccctcgaaatcgcgctggccgtgtccaagcactacggtttc cagctcaagtccgacaacgagaacaaccgcgcgatcttcacgagtctgcgcacgctgtcc gagcatatcgagcagcaccgcgccgcggcctga

DBGET integrated database retrieval system