Leptospirillum ferriphilum YSK: Y981_05020 Help Entry Y981_05020        CDS       T03197                                  Name (GenBank) hypothetical protein   KO K05788   integration host factor subunit beta Organism lfp  Leptospirillum ferriphilum YSK Brite KEGG Orthology (KO) [BR:lfp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lfp03032]     Y981_05020    03036 Chromosome and associated proteins [BR:lfp03036]     Y981_05020    03400 DNA repair and recombination proteins [BR:lfp03400]     Y981_05020 DNA replication proteins [BR:lfp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Y981_05020 Chromosome and associated proteins [BR:lfp03036]  Prokaryotic type   Nucleoid associated proteins    IHF (integration host factor)     Y981_05020 DNA repair and recombination proteins [BR:lfp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       Y981_05020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AIA30362 UniProt:  A0A059XYR9 LinkDB All DBs Position 920499..920795 Genome browser AA seq 98 aa AA seqDB search MTRDDLIKRIAEKNAGISLSDSRELVLDLFESMKSVILEGESLEIRRFGVFEIHHRKPRI ARNPRTGEKVSVGERKSLIFRPGKILKLRMKNLTRKSI NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacccgagacgacctgataaagcgaattgcagaaaaaaacgctggtatttccctgtct gattcaagagaattggtccttgatctttttgagtcgatgaagtccgttattctggaaggc gagtctctggaaatccgacgctttggtgtttttgagattcaccaccggaagccgcgaatt gccagaaatcccagaacaggggaaaaagtgtctgtaggagagcgcaagagccttattttt cggccaggtaaaatcttgaaacttcggatgaaaaatctgacaaggaagtccatctga

DBGET integrated database retrieval system