Leptospirillum ferriphilum YSK: Y981_06145
Help
Entry
Y981_06145 CDS
T03197
Name
(GenBank) aspartate aminotransferase
KO
K00812
aspartate aminotransferase [EC:
2.6.1.1
]
Organism
lfp
Leptospirillum ferriphilum YSK
Pathway
lfp00220
Arginine biosynthesis
lfp00250
Alanine, aspartate and glutamate metabolism
lfp00270
Cysteine and methionine metabolism
lfp00330
Arginine and proline metabolism
lfp00350
Tyrosine metabolism
lfp00360
Phenylalanine metabolism
lfp00400
Phenylalanine, tyrosine and tryptophan biosynthesis
lfp00401
Novobiocin biosynthesis
lfp01100
Metabolic pathways
lfp01110
Biosynthesis of secondary metabolites
lfp01210
2-Oxocarboxylic acid metabolism
lfp01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
lfp00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
Y981_06145
00270 Cysteine and methionine metabolism
Y981_06145
00220 Arginine biosynthesis
Y981_06145
00330 Arginine and proline metabolism
Y981_06145
00350 Tyrosine metabolism
Y981_06145
00360 Phenylalanine metabolism
Y981_06145
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
Y981_06145
09110 Biosynthesis of other secondary metabolites
00401 Novobiocin biosynthesis
Y981_06145
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
lfp01007
]
Y981_06145
Enzymes [BR:
lfp01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
Y981_06145
Amino acid related enzymes [BR:
lfp01007
]
Aminotransferase (transaminase)
Class I
Y981_06145
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
DegT_DnrJ_EryC1
Radical_SAM
Cys_Met_Meta_PP
Cas_csx3
Motif
Other DBs
NCBI-ProteinID:
AIA30496
UniProt:
A0A059XYX1
LinkDB
All DBs
Position
1136409..1137620
Genome browser
AA seq
403 aa
AA seq
DB search
MSQTPKFTLSNRLSRLKPSPTLQLAARARELKEQGIDVLDFSGGEPDFRTPEEVGEAAIK
AIRDGFTKYTAVGGISELKEAIVAKFERDQKITYTPKDIVVSCGAKHSLFQIFQALVNPG
DQVLLPSPAWVSYPDQIYLNGGEPVFVPCREEDGFRLTPEAVEAAITPRSRILVLNSPNN
PTGAVIGQRALEGIGELALKHNLLIISDEIYEKIVYDNHRSISIATLDPRLKESTIIVNG
VSKTYSMTGWRIGYAAGPREIMQAVDSIQSQTTSNPTSISQKAAAFALSSGDRFFLPMLS
AYGKRREAVVEALNQVPGITCKKPDGAFYAFLNISGLLGKSYRGHPLLNVYELAEFFLDV
AKVTIVPGAPFGNDHHMRMSFAASLSVLQAGIERIRDAVSRMD
NT seq
1212 nt
NT seq
+upstream
nt +downstream
nt
atgagccagacgcccaaatttaccctttccaaccgtctttcccgcctgaaaccttctccg
acgctccagctggcggcccgcgcgcgggaactgaaggagcaggggattgatgtccttgat
ttctcgggaggcgagccggatttccggacccccgaagaagtgggggaggctgcgataaaa
gcgatccgggacggattcaccaaatacacagccgtgggcggcatctccgagctgaaggaa
gcgatcgtggcaaaattcgagcgcgatcagaagatcacctacacccccaaggatattgtt
gtttcctgtggagccaagcactccctgtttcagattttccaggcccttgtgaaccccggg
gaccaggttcttcttccgagccccgcctgggtttcctatcccgaccagatctatctgaac
ggaggagaacctgtttttgttccctgccgggaagaagacggctttcgtctcaccccggaa
gcggttgaagcagcgattacaccccgttcccggattcttgtcctgaattctcccaacaat
ccgacaggagcggtgattggccagcgtgccctggaagggatcggggaacttgccctcaag
cataatctcctgattatttcggacgagatttatgaaaaaatcgtctatgacaatcaccgg
tctatctccattgcgactttggatccccggctgaaagaatccaccattatcgtcaacggt
gtctcgaagacctactccatgaccggatggcgtatcggttacgcggcggggccgcgggag
atcatgcaggccgtcgacagtatccagagccagacgacctccaaccccacatccatctcg
caaaaagccgccgcctttgccctttcttcgggagaccgcttcttccttcccatgctgtct
gcctatgggaagcgacgggaagcggttgtggaggccctgaaccaggttccgggcatcacc
tgcaaaaagccggacggggcgttctatgcgtttttaaatatttccgggttgctcggaaag
tcttaccggggccatcctctcctgaatgtctatgaactggcggagttttttcttgatgtg
gccaaggtgacgatcgttccgggggcgcctttcgggaacgatcatcacatgcggatgtct
tttgcggcatcgctttccgttcttcaggcgggtattgaacgtatccgggacgccgtctcc
cggatggattga
DBGET
integrated database retrieval system