KEGG   Leptospirillum ferriphilum YSK: Y981_06145
Entry
Y981_06145        CDS       T03197                                 
Name
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
lfp  Leptospirillum ferriphilum YSK
Pathway
lfp00220  Arginine biosynthesis
lfp00250  Alanine, aspartate and glutamate metabolism
lfp00270  Cysteine and methionine metabolism
lfp00330  Arginine and proline metabolism
lfp00350  Tyrosine metabolism
lfp00360  Phenylalanine metabolism
lfp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lfp00401  Novobiocin biosynthesis
lfp01100  Metabolic pathways
lfp01110  Biosynthesis of secondary metabolites
lfp01210  2-Oxocarboxylic acid metabolism
lfp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y981_06145
   00270 Cysteine and methionine metabolism
    Y981_06145
   00220 Arginine biosynthesis
    Y981_06145
   00330 Arginine and proline metabolism
    Y981_06145
   00350 Tyrosine metabolism
    Y981_06145
   00360 Phenylalanine metabolism
    Y981_06145
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Y981_06145
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Y981_06145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lfp01007]
    Y981_06145
Enzymes [BR:lfp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Y981_06145
Amino acid related enzymes [BR:lfp01007]
 Aminotransferase (transaminase)
  Class I
   Y981_06145
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Radical_SAM Cys_Met_Meta_PP Cas_csx3
Other DBs
NCBI-ProteinID: AIA30496
UniProt: A0A059XYX1
LinkDB
Position
1136409..1137620
AA seq 403 aa
MSQTPKFTLSNRLSRLKPSPTLQLAARARELKEQGIDVLDFSGGEPDFRTPEEVGEAAIK
AIRDGFTKYTAVGGISELKEAIVAKFERDQKITYTPKDIVVSCGAKHSLFQIFQALVNPG
DQVLLPSPAWVSYPDQIYLNGGEPVFVPCREEDGFRLTPEAVEAAITPRSRILVLNSPNN
PTGAVIGQRALEGIGELALKHNLLIISDEIYEKIVYDNHRSISIATLDPRLKESTIIVNG
VSKTYSMTGWRIGYAAGPREIMQAVDSIQSQTTSNPTSISQKAAAFALSSGDRFFLPMLS
AYGKRREAVVEALNQVPGITCKKPDGAFYAFLNISGLLGKSYRGHPLLNVYELAEFFLDV
AKVTIVPGAPFGNDHHMRMSFAASLSVLQAGIERIRDAVSRMD
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagccagacgcccaaatttaccctttccaaccgtctttcccgcctgaaaccttctccg
acgctccagctggcggcccgcgcgcgggaactgaaggagcaggggattgatgtccttgat
ttctcgggaggcgagccggatttccggacccccgaagaagtgggggaggctgcgataaaa
gcgatccgggacggattcaccaaatacacagccgtgggcggcatctccgagctgaaggaa
gcgatcgtggcaaaattcgagcgcgatcagaagatcacctacacccccaaggatattgtt
gtttcctgtggagccaagcactccctgtttcagattttccaggcccttgtgaaccccggg
gaccaggttcttcttccgagccccgcctgggtttcctatcccgaccagatctatctgaac
ggaggagaacctgtttttgttccctgccgggaagaagacggctttcgtctcaccccggaa
gcggttgaagcagcgattacaccccgttcccggattcttgtcctgaattctcccaacaat
ccgacaggagcggtgattggccagcgtgccctggaagggatcggggaacttgccctcaag
cataatctcctgattatttcggacgagatttatgaaaaaatcgtctatgacaatcaccgg
tctatctccattgcgactttggatccccggctgaaagaatccaccattatcgtcaacggt
gtctcgaagacctactccatgaccggatggcgtatcggttacgcggcggggccgcgggag
atcatgcaggccgtcgacagtatccagagccagacgacctccaaccccacatccatctcg
caaaaagccgccgcctttgccctttcttcgggagaccgcttcttccttcccatgctgtct
gcctatgggaagcgacgggaagcggttgtggaggccctgaaccaggttccgggcatcacc
tgcaaaaagccggacggggcgttctatgcgtttttaaatatttccgggttgctcggaaag
tcttaccggggccatcctctcctgaatgtctatgaactggcggagttttttcttgatgtg
gccaaggtgacgatcgttccgggggcgcctttcgggaacgatcatcacatgcggatgtct
tttgcggcatcgctttccgttcttcaggcgggtattgaacgtatccgggacgccgtctcc
cggatggattga

DBGET integrated database retrieval system