Leptospirillum ferriphilum YSK: Y981_10920 Help Entry Y981_10920        CDS       T03197                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lfp  Leptospirillum ferriphilum YSK Pathway lfp01100   Metabolic pathways lfp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lfp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Y981_10920    00074 Mycolic acid biosynthesis     Y981_10920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Y981_10920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DnaT_2 HLH Motif Other DBs NCBI-ProteinID:  AIA31065 UniProt:  A0A059XVB3 LinkDB All DBs Position complement(1956229..1956459) Genome browser AA seq 76 aa AA seqDB search MAIEERVKKIIAEQLGVEDEEVNPESRFVEDLGADSLDTVELVMALEEEFGIEIPDEDAE KIATVQNAIDYISERV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctattgaagagcgcgtcaaaaaaattattgctgaacagttgggtgttgaggatgag gaagtcaatccggagtcccgcttcgtggaagatctgggagccgattccctcgacacagtc gaactggtcatggcgctggaagaagagttcgggatcgagattccggatgaagatgccgaa aaaattgccaccgttcagaacgccatcgactatatcagcgagcgtgtttga

DBGET integrated database retrieval system