Leptospirillum ferriphilum YSK: Y981_11095
Help
Entry
Y981_11095 CDS
T03197
Name
(GenBank) peptidase S66
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
lfp
Leptospirillum ferriphilum YSK
Brite
KEGG Orthology (KO) [BR:
lfp00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
lfp01002
]
Y981_11095
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
lfp01011
]
Y981_11095
Enzymes [BR:
lfp01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
Y981_11095
Peptidases and inhibitors [BR:
lfp01002
]
Serine peptidases
Family S66
Y981_11095
Peptidoglycan biosynthesis and degradation proteins [BR:
lfp01011
]
Precursor biosynthesis
Carboxypeptidase
Y981_11095
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
AIA31090
UniProt:
A0A059XVD9
LinkDB
All DBs
Position
1986768..1987727
Genome browser
AA seq
319 aa
AA seq
DB search
MDGGIAIRPLLKPDAPLKPGDRLTLVASSLHGVPESYPEGLARLRSKGLEITNGDPEGPP
CGPFSADDRTRAERFIGALSEEGSRAVMALRGGYGAIRLLPHLDTLPWRSPRFPIWTGFS
DATNLHAYLWHRLNAVTFHGPHPRGLGASEESFNWYWEMVSGKVKAGDSLPLGQAEVVRP
GEARGRLLGGNLETLAHLSGTPWFPDFDGAILLLEDVDEPMYAIDRALRHLSHLGVFSKI
AGLVLGPFSGRPAREDDPAGDVAELLEPLCPSGIPVLKTPLPGHDLPMATWPLNLPVRMT
VPSSGQPSLMLLESPFQEG
NT seq
960 nt
NT seq
+upstream
nt +downstream
nt
atggacggaggaatcgccatcaggcccctcctgaaaccggatgccccgctcaaacccggc
gaccggctgacccttgtcgcgtccagtttacacggtgtcccggaaagctacccggaagga
ttggcccgtcttcgaagcaagggccttgaaatcaccaacggcgatccggaaggccccccc
tgcggccccttttccgccgacgaccggacccgggcggaacgcttcatcggtgccctttca
gaggaggggtcccgcgctgtcatggctttgcggggaggatacggggccatccgcctgctc
ccccacctggacactcttccctggagatctccccgttttcccatatggacgggattttcg
gacgcgaccaacctccacgcctatctctggcatcgcctgaacgcggtcaccttccatgga
ccccatccccgagggcttggtgcttcggaagaaagcttcaactggtactgggagatggtc
tccgggaaggtcaaagccggagattcccttcccctcggacaggcggaagtcgttcgtccc
ggggaggcccggggacgtcttctgggagggaatctcgaaacgctggcgcatctttccgga
acaccctggtttccggacttcgacggcgccattcttcttctggaagatgtcgacgaaccg
atgtacgcgatcgaccgggcgttgagacacctgtcccatctgggagtcttctcaaaaatt
gcggggctcgtgctggggcctttttccggtcgcccggcccgggaggacgaccccgccgga
gacgtcgccgaactgctggagcccttgtgtccgtcggggattccggttctgaaaacccct
ctgcccggccacgaccttcccatggcgacatggcctctcaatctccctgtccggatgacc
gtgccttcctccggacagccttccctcatgcttctggaatccccttttcaggaagggtag
DBGET
integrated database retrieval system