Luteimonas fraxinea: LU699_04760 Help Entry LU699_04760       CDS       T09935                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism lfx  Luteimonas fraxinea Brite KEGG Orthology (KO) [BR:lfx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lfx03036]     LU699_04760 (ftsL) Chromosome and associated proteins [BR:lfx03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LU699_04760 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF3467 Motif Other DBs NCBI-ProteinID:  UHH11844 LinkDB All DBs Position complement(1073137..1073400) Genome browser AA seq 87 aa AA seqDB search MRHLVVAILLAANVITAIGVVHARHDYRQLYIDLTRLERARDELNIDFGRLQLEQATWAM SNRVDQVARERLGMRFPETAEIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt ttgcgccatctcgtcgtcgcgatcctgctggccgccaacgtgatcaccgcgatcggcgtg gtgcacgcgcgccacgattatcgccagctctacatcgatctgacccgtctggagcgcgcg cgcgacgaactcaacatcgacttcggccgtctgcagctcgagcaggcgacgtgggcgatg agcaaccgagtcgaccaggtcgcgcgcgaacgtctgggcatgcgattccccgagacggcc gagatcgtcgtggtgcgcccatga

DBGET integrated database retrieval system