KEGG   Luteimonas fraxinea: LU699_13915
Entry
LU699_13915       CDS       T09935                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
lfx  Luteimonas fraxinea
Pathway
lfx00770  Pantothenate and CoA biosynthesis
lfx01100  Metabolic pathways
lfx01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:lfx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LU699_13915 (coaD)
Enzymes [BR:lfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     LU699_13915 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: UHH09376
LinkDB
Position
3092079..3092573
AA seq 164 aa
MSASRHRIAVYPGTFDPITNGHVDLVDRAAPLFEKLIVGIAESPAKRPAMTLEERVELAR
VATAHHTNVEVIGFDSLLAHFVHEVGAGVLLRGLRAVSDFEYEFQLASMNRHLIPDVETL
FLTPAEQYGFISSTLVREISRLGGDVSGFVPAAVDRALRKHSQR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagtgcgagccgccaccgcatcgcggtctatcccgggaccttcgatccgatcaccaac
ggccacgtcgacctcgtcgaccgtgccgcgccgctgttcgagaaactgatcgtcggcatc
gccgaaagtccggccaagcgcccggcgatgacgctcgaagagcgcgtcgaactggcccgc
gtcgcgaccgcccaccacaccaatgtcgaggtcatcggcttcgactcgctgctcgcgcat
ttcgtgcacgaagtcggcgccggtgtgctgctgcgcggtctgcgcgcggtgtcggatttc
gaatacgaattccagctcgccagcatgaaccggcatctgattccggatgtcgaaacgctg
ttcctcacgccggccgagcagtacggcttcatctcctccacgctggtgcgcgagatctcg
cgtctcggcggtgacgtgtcgggcttcgtgcccgccgctgtcgatcgcgcattgcgcaaa
cactcgcaacgctga

DBGET integrated database retrieval system