Leopardus geoffroyi (Geoffroy's cat): 123575914 Help Entry 123575914         CDS       T10761                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04146   Peroxisome lgf04213   Longevity regulating pathway - multiple species lgf05012   Parkinson disease lgf05014   Amyotrophic lateral sclerosis lgf05016   Huntington disease lgf05020   Prion disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:lgf00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     123575914 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     123575914 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     123575914 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     123575914 (SOD1)    05014 Amyotrophic lateral sclerosis     123575914 (SOD1)    05016 Huntington disease     123575914 (SOD1)    05020 Prion disease     123575914 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     123575914 (SOD1) Enzymes [BR:lgf01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      123575914 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  123575914 NCBI-ProteinID:  XP_045292842 LinkDB All DBs Position C2:complement(13409425..13418225) Genome browser AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGNGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVANVSLEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggagggcaccatccac ttcgtacagaagggcaatgggcctgttgtggtatcaggaaccattacaggattgactgaa ggcgagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagtgca ggccctcactttaatcctctatccaaaaaacatggtgggccaaaagatcaagagaggcat gttggagaccttggcaacgtaactgctggcaaggacggtgtggccaacgtgtctctggaa gattctctgattgcactctcaggagaccattccatcattggccgcacgatggtggtccac gagaaacgagatgacttgggcaaaggtggaaatgaagaaagtacgcaaacgggaaacgct gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system