KEGG   Leopardus geoffroyi (Geoffroy's cat): 123589819
Entry
123589819         CDS       T10761                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lgf  Leopardus geoffroyi (Geoffroy's cat)
Pathway
lgf01521  EGFR tyrosine kinase inhibitor resistance
lgf01522  Endocrine resistance
lgf01524  Platinum drug resistance
lgf04010  MAPK signaling pathway
lgf04012  ErbB signaling pathway
lgf04014  Ras signaling pathway
lgf04015  Rap1 signaling pathway
lgf04022  cGMP-PKG signaling pathway
lgf04024  cAMP signaling pathway
lgf04062  Chemokine signaling pathway
lgf04066  HIF-1 signaling pathway
lgf04068  FoxO signaling pathway
lgf04071  Sphingolipid signaling pathway
lgf04072  Phospholipase D signaling pathway
lgf04114  Oocyte meiosis
lgf04140  Autophagy - animal
lgf04148  Efferocytosis
lgf04150  mTOR signaling pathway
lgf04151  PI3K-Akt signaling pathway
lgf04210  Apoptosis
lgf04218  Cellular senescence
lgf04261  Adrenergic signaling in cardiomyocytes
lgf04270  Vascular smooth muscle contraction
lgf04350  TGF-beta signaling pathway
lgf04360  Axon guidance
lgf04370  VEGF signaling pathway
lgf04371  Apelin signaling pathway
lgf04380  Osteoclast differentiation
lgf04510  Focal adhesion
lgf04517  IgSF CAM signaling
lgf04520  Adherens junction
lgf04540  Gap junction
lgf04550  Signaling pathways regulating pluripotency of stem cells
lgf04611  Platelet activation
lgf04613  Neutrophil extracellular trap formation
lgf04620  Toll-like receptor signaling pathway
lgf04621  NOD-like receptor signaling pathway
lgf04625  C-type lectin receptor signaling pathway
lgf04650  Natural killer cell mediated cytotoxicity
lgf04657  IL-17 signaling pathway
lgf04658  Th1 and Th2 cell differentiation
lgf04659  Th17 cell differentiation
lgf04660  T cell receptor signaling pathway
lgf04662  B cell receptor signaling pathway
lgf04664  Fc epsilon RI signaling pathway
lgf04666  Fc gamma R-mediated phagocytosis
lgf04668  TNF signaling pathway
lgf04713  Circadian entrainment
lgf04720  Long-term potentiation
lgf04722  Neurotrophin signaling pathway
lgf04723  Retrograde endocannabinoid signaling
lgf04724  Glutamatergic synapse
lgf04725  Cholinergic synapse
lgf04726  Serotonergic synapse
lgf04730  Long-term depression
lgf04810  Regulation of actin cytoskeleton
lgf04910  Insulin signaling pathway
lgf04912  GnRH signaling pathway
lgf04914  Progesterone-mediated oocyte maturation
lgf04915  Estrogen signaling pathway
lgf04916  Melanogenesis
lgf04917  Prolactin signaling pathway
lgf04919  Thyroid hormone signaling pathway
lgf04921  Oxytocin signaling pathway
lgf04926  Relaxin signaling pathway
lgf04928  Parathyroid hormone synthesis, secretion and action
lgf04929  GnRH secretion
lgf04930  Type II diabetes mellitus
lgf04933  AGE-RAGE signaling pathway in diabetic complications
lgf04934  Cushing syndrome
lgf04935  Growth hormone synthesis, secretion and action
lgf04960  Aldosterone-regulated sodium reabsorption
lgf05010  Alzheimer disease
lgf05020  Prion disease
lgf05022  Pathways of neurodegeneration - multiple diseases
lgf05034  Alcoholism
lgf05132  Salmonella infection
lgf05133  Pertussis
lgf05135  Yersinia infection
lgf05140  Leishmaniasis
lgf05142  Chagas disease
lgf05145  Toxoplasmosis
lgf05152  Tuberculosis
lgf05160  Hepatitis C
lgf05161  Hepatitis B
lgf05163  Human cytomegalovirus infection
lgf05164  Influenza A
lgf05165  Human papillomavirus infection
lgf05166  Human T-cell leukemia virus 1 infection
lgf05167  Kaposi sarcoma-associated herpesvirus infection
lgf05170  Human immunodeficiency virus 1 infection
lgf05171  Coronavirus disease - COVID-19
lgf05200  Pathways in cancer
lgf05203  Viral carcinogenesis
lgf05205  Proteoglycans in cancer
lgf05206  MicroRNAs in cancer
lgf05207  Chemical carcinogenesis - receptor activation
lgf05208  Chemical carcinogenesis - reactive oxygen species
lgf05210  Colorectal cancer
lgf05211  Renal cell carcinoma
lgf05212  Pancreatic cancer
lgf05213  Endometrial cancer
lgf05214  Glioma
lgf05215  Prostate cancer
lgf05216  Thyroid cancer
lgf05218  Melanoma
lgf05219  Bladder cancer
lgf05220  Chronic myeloid leukemia
lgf05221  Acute myeloid leukemia
lgf05223  Non-small cell lung cancer
lgf05224  Breast cancer
lgf05225  Hepatocellular carcinoma
lgf05226  Gastric cancer
lgf05230  Central carbon metabolism in cancer
lgf05231  Choline metabolism in cancer
lgf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lgf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lgf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123589819 (MAPK3)
   04012 ErbB signaling pathway
    123589819 (MAPK3)
   04014 Ras signaling pathway
    123589819 (MAPK3)
   04015 Rap1 signaling pathway
    123589819 (MAPK3)
   04350 TGF-beta signaling pathway
    123589819 (MAPK3)
   04370 VEGF signaling pathway
    123589819 (MAPK3)
   04371 Apelin signaling pathway
    123589819 (MAPK3)
   04668 TNF signaling pathway
    123589819 (MAPK3)
   04066 HIF-1 signaling pathway
    123589819 (MAPK3)
   04068 FoxO signaling pathway
    123589819 (MAPK3)
   04072 Phospholipase D signaling pathway
    123589819 (MAPK3)
   04071 Sphingolipid signaling pathway
    123589819 (MAPK3)
   04024 cAMP signaling pathway
    123589819 (MAPK3)
   04022 cGMP-PKG signaling pathway
    123589819 (MAPK3)
   04151 PI3K-Akt signaling pathway
    123589819 (MAPK3)
   04150 mTOR signaling pathway
    123589819 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    123589819 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123589819 (MAPK3)
   04148 Efferocytosis
    123589819 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    123589819 (MAPK3)
   04210 Apoptosis
    123589819 (MAPK3)
   04218 Cellular senescence
    123589819 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    123589819 (MAPK3)
   04520 Adherens junction
    123589819 (MAPK3)
   04540 Gap junction
    123589819 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    123589819 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123589819 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123589819 (MAPK3)
   04613 Neutrophil extracellular trap formation
    123589819 (MAPK3)
   04620 Toll-like receptor signaling pathway
    123589819 (MAPK3)
   04621 NOD-like receptor signaling pathway
    123589819 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    123589819 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    123589819 (MAPK3)
   04660 T cell receptor signaling pathway
    123589819 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    123589819 (MAPK3)
   04659 Th17 cell differentiation
    123589819 (MAPK3)
   04657 IL-17 signaling pathway
    123589819 (MAPK3)
   04662 B cell receptor signaling pathway
    123589819 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    123589819 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    123589819 (MAPK3)
   04062 Chemokine signaling pathway
    123589819 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123589819 (MAPK3)
   04929 GnRH secretion
    123589819 (MAPK3)
   04912 GnRH signaling pathway
    123589819 (MAPK3)
   04915 Estrogen signaling pathway
    123589819 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    123589819 (MAPK3)
   04917 Prolactin signaling pathway
    123589819 (MAPK3)
   04921 Oxytocin signaling pathway
    123589819 (MAPK3)
   04926 Relaxin signaling pathway
    123589819 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    123589819 (MAPK3)
   04919 Thyroid hormone signaling pathway
    123589819 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    123589819 (MAPK3)
   04916 Melanogenesis
    123589819 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123589819 (MAPK3)
   04270 Vascular smooth muscle contraction
    123589819 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    123589819 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    123589819 (MAPK3)
   04725 Cholinergic synapse
    123589819 (MAPK3)
   04726 Serotonergic synapse
    123589819 (MAPK3)
   04720 Long-term potentiation
    123589819 (MAPK3)
   04730 Long-term depression
    123589819 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    123589819 (MAPK3)
   04722 Neurotrophin signaling pathway
    123589819 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    123589819 (MAPK3)
   04380 Osteoclast differentiation
    123589819 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    123589819 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123589819 (MAPK3)
   05206 MicroRNAs in cancer
    123589819 (MAPK3)
   05205 Proteoglycans in cancer
    123589819 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    123589819 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    123589819 (MAPK3)
   05203 Viral carcinogenesis
    123589819 (MAPK3)
   05230 Central carbon metabolism in cancer
    123589819 (MAPK3)
   05231 Choline metabolism in cancer
    123589819 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123589819 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123589819 (MAPK3)
   05212 Pancreatic cancer
    123589819 (MAPK3)
   05225 Hepatocellular carcinoma
    123589819 (MAPK3)
   05226 Gastric cancer
    123589819 (MAPK3)
   05214 Glioma
    123589819 (MAPK3)
   05216 Thyroid cancer
    123589819 (MAPK3)
   05221 Acute myeloid leukemia
    123589819 (MAPK3)
   05220 Chronic myeloid leukemia
    123589819 (MAPK3)
   05218 Melanoma
    123589819 (MAPK3)
   05211 Renal cell carcinoma
    123589819 (MAPK3)
   05219 Bladder cancer
    123589819 (MAPK3)
   05215 Prostate cancer
    123589819 (MAPK3)
   05213 Endometrial cancer
    123589819 (MAPK3)
   05224 Breast cancer
    123589819 (MAPK3)
   05223 Non-small cell lung cancer
    123589819 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123589819 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    123589819 (MAPK3)
   05161 Hepatitis B
    123589819 (MAPK3)
   05160 Hepatitis C
    123589819 (MAPK3)
   05171 Coronavirus disease - COVID-19
    123589819 (MAPK3)
   05164 Influenza A
    123589819 (MAPK3)
   05163 Human cytomegalovirus infection
    123589819 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123589819 (MAPK3)
   05165 Human papillomavirus infection
    123589819 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    123589819 (MAPK3)
   05135 Yersinia infection
    123589819 (MAPK3)
   05133 Pertussis
    123589819 (MAPK3)
   05152 Tuberculosis
    123589819 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    123589819 (MAPK3)
   05140 Leishmaniasis
    123589819 (MAPK3)
   05142 Chagas disease
    123589819 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123589819 (MAPK3)
   05020 Prion disease
    123589819 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    123589819 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    123589819 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123589819 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    123589819 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    123589819 (MAPK3)
   04934 Cushing syndrome
    123589819 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123589819 (MAPK3)
   01524 Platinum drug resistance
    123589819 (MAPK3)
   01522 Endocrine resistance
    123589819 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lgf01001]
    123589819 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lgf03036]
    123589819 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgf04147]
    123589819 (MAPK3)
Enzymes [BR:lgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     123589819 (MAPK3)
Protein kinases [BR:lgf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   123589819 (MAPK3)
Chromosome and associated proteins [BR:lgf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     123589819 (MAPK3)
Exosome [BR:lgf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   123589819 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 123589819
NCBI-ProteinID: XP_045318404
LinkDB
Position
E3:complement(18949870..18956114)
AA seq 435 aa
MPRAFWAGGTPRALRRRGLREAGGSPTEGTLGCFLGERRCVRSNGRGLGGRRSAHSVVRG
GASECTWGSCGALGDPTDSGRGGETKYSWGGDIVSEERAKDPTLGRGCLGFSHSAYDHVR
KTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDL
METDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDAKAL
DLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELI
FQETARFQPGALEAP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgccgagggccttctgggccggggggactcccagggccctgaggaggcgggggcttcgg
gaggctggggggagtcccacggaggggaccttgggctgctttctgggggagcggcgctgc
gtacgttctaatgggagggggcttggaggccgcagaagcgcccattccgttgtgagggga
ggggcatctgagtgtacgtgggggagctgtggggccctcggggaccctacggactcgggg
agaggcggagaaactaagtattcttggggaggtgatatcgtcagcgaagagcgagcgaag
gaccctactctggggagaggatgccttggattctcccactcagcttatgaccacgtgcgc
aagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacctattgccagcgc
acactgcgggagatccagatcttgttgcgcttccgccatgagaacgtcattggcatccgg
gacattctgcgggcgcccaccctggaagccatgagggatgtctacattgtgcaggacctg
atggagacggacctgtacaagttgctcaaaagccagcagctgagcaacgaccacatctgc
tacttcctctaccagatcctgcggggcctcaagtatatccactcagccaacgtgctccac
cgagatttaaagccctctaacctgctcatcaacaccacctgcgaccttaagatctgtgat
tttggcctggcccggattgccgatcctgagcatgaccacactggcttcctgacagaatat
gtggccacacgctggtaccgggctccagaaatcatgcttaactccaagggctacaccaag
tccatcgacatctggtctgtgggctgcattctggctgagatgctctccaacaggcccatc
ttccctggcaagcactacctggaccagctcaaccacattctggggatcctgggctcccca
tcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactacctacagtctctg
ccctccaagaccaaggtggcctgggccaagctttttcccaagtcagatgccaaagccctt
gatctgctagaccggatgttgacctttaaccccaacaaacggatcacagtggaggaagca
ctggctcacccctacctggagcagtactacgacccaacggatgagccagtggccgaggag
cctttcaccttcgacatggagctggatgatctacccaaggagcggctgaaggagctcatc
ttccaggagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system