Leopardus geoffroyi (Geoffroy's cat): 123590817 Help Entry 123590817         CDS       T10761                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04014   Ras signaling pathway lgf04015   Rap1 signaling pathway lgf04020   Calcium signaling pathway lgf04022   cGMP-PKG signaling pathway lgf04024   cAMP signaling pathway lgf04070   Phosphatidylinositol signaling system lgf04114   Oocyte meiosis lgf04218   Cellular senescence lgf04261   Adrenergic signaling in cardiomyocytes lgf04270   Vascular smooth muscle contraction lgf04371   Apelin signaling pathway lgf04625   C-type lectin receptor signaling pathway lgf04713   Circadian entrainment lgf04720   Long-term potentiation lgf04722   Neurotrophin signaling pathway lgf04728   Dopaminergic synapse lgf04740   Olfactory transduction lgf04744   Phototransduction lgf04750   Inflammatory mediator regulation of TRP channels lgf04910   Insulin signaling pathway lgf04912   GnRH signaling pathway lgf04915   Estrogen signaling pathway lgf04916   Melanogenesis lgf04921   Oxytocin signaling pathway lgf04922   Glucagon signaling pathway lgf04924   Renin secretion lgf04925   Aldosterone synthesis and secretion lgf04970   Salivary secretion lgf04971   Gastric acid secretion lgf05010   Alzheimer disease lgf05012   Parkinson disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05031   Amphetamine addiction lgf05034   Alcoholism lgf05133   Pertussis lgf05152   Tuberculosis lgf05163   Human cytomegalovirus infection lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05170   Human immunodeficiency virus 1 infection lgf05200   Pathways in cancer lgf05214   Glioma lgf05417   Lipid and atherosclerosis lgf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123590817    04015 Rap1 signaling pathway     123590817    04371 Apelin signaling pathway     123590817    04020 Calcium signaling pathway     123590817    04070 Phosphatidylinositol signaling system     123590817    04024 cAMP signaling pathway     123590817    04022 cGMP-PKG signaling pathway     123590817  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     123590817    04218 Cellular senescence     123590817  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123590817   09152 Endocrine system    04910 Insulin signaling pathway     123590817    04922 Glucagon signaling pathway     123590817    04912 GnRH signaling pathway     123590817    04915 Estrogen signaling pathway     123590817    04921 Oxytocin signaling pathway     123590817    04916 Melanogenesis     123590817    04924 Renin secretion     123590817    04925 Aldosterone synthesis and secretion     123590817   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     123590817    04270 Vascular smooth muscle contraction     123590817   09154 Digestive system    04970 Salivary secretion     123590817    04971 Gastric acid secretion     123590817   09156 Nervous system    04728 Dopaminergic synapse     123590817    04720 Long-term potentiation     123590817    04722 Neurotrophin signaling pathway     123590817   09157 Sensory system    04744 Phototransduction     123590817    04740 Olfactory transduction     123590817    04750 Inflammatory mediator regulation of TRP channels     123590817   09159 Environmental adaptation    04713 Circadian entrainment     123590817  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123590817   09162 Cancer: specific types    05214 Glioma     123590817   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123590817    05163 Human cytomegalovirus infection     123590817    05167 Kaposi sarcoma-associated herpesvirus infection     123590817   09171 Infectious disease: bacterial    05133 Pertussis     123590817    05152 Tuberculosis     123590817   09164 Neurodegenerative disease    05010 Alzheimer disease     123590817    05012 Parkinson disease     123590817    05022 Pathways of neurodegeneration - multiple diseases     123590817   09165 Substance dependence    05031 Amphetamine addiction     123590817    05034 Alcoholism     123590817   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123590817    05418 Fluid shear stress and atherosclerosis     123590817  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lgf01009]     123590817   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123590817    03036 Chromosome and associated proteins [BR:lgf03036]     123590817   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123590817 Protein phosphatases and associated proteins [BR:lgf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123590817 Membrane trafficking [BR:lgf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     123590817 Chromosome and associated proteins [BR:lgf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      123590817 Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    123590817 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 Allatotropin-like_C SPARC_Ca_bdg EH UPF0154 CFAP251_C EF_EFCAB10_C SAPC2_N EF-hand_EFHB_C Dockerin_1 EF-hand_STIM1 ERAP1_C DUF5580_M SurA_N_3 SCO1-SenC Motif Other DBs NCBI-GeneID:  123590817 NCBI-ProteinID:  XP_045320287 LinkDB All DBs Position B4:complement(4697827..4699125) Genome browser AA seq 217 aa AA seqDB search MGRAESLPPPFAPNAEKEGGSIPWQDCHGSSALTQTQPRVPAAGPRLRREPFEPSGSRLG SSVTGVRDMAEQLSKEQVAEFKEAFDRVDKDGDGKIDVQELGAVMQAVGKNPSEAELKQL ISRVDTDGDGHISFDEFLAEMAKIMKASGSEAEMREVFRAFDLDGDGHISVNELKQAMAK LGENPSQEELDAMIQGADVDQDGQVNYEEFVRILSQK NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggggagggcggagagccttcctcctccctttgctccgaatgcagaaaaggaggggggt tccatcccatggcaagactgccacgggagctctgccctcacacagacacagcctcgcgtc ccagccgccggtccccgtctccgacgtgagccctttgagccaagtggcagccggctcgga agctctgtgacaggtgtacgtgacatggcagagcagctgtctaaagaacaggtggccgag ttcaaggaggccttcgacagggttgacaaggacggggatggaaagatcgacgtccaggag ctgggtgccgtgatgcaggccgtgggcaagaacccgtcggaagccgagctgaagcagctc atctcccgggtggataccgatggcgacggccacatcagcttcgacgagttcctggcagag atggccaagatcatgaaggcctcgggcagcgaggcggagatgcgggaagtcttccgtgcc ttcgacctggatggcgacggccacatcagcgtcaacgagctcaagcaggccatggccaag ctgggcgagaatccttcccaggaggagctggacgccatgatccagggcgccgacgtggac caggacgggcaggtgaactacgaggagttcgtgcgcatcctctctcagaagtga

DBGET integrated database retrieval system