Leopardus geoffroyi (Geoffroy's cat): 123590884 Help Entry 123590884         CDS       T10761                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04014   Ras signaling pathway lgf04137   Mitophagy - animal lgf04144   Endocytosis lgf04145   Phagosome lgf04148   Efferocytosis lgf04962   Vasopressin-regulated water reabsorption lgf05132   Salmonella infection lgf05146   Amoebiasis lgf05152   Tuberculosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123590884 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123590884 (RAB5B)    04145 Phagosome     123590884 (RAB5B)    04137 Mitophagy - animal     123590884 (RAB5B)    04148 Efferocytosis     123590884 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     123590884 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123590884 (RAB5B)    05152 Tuberculosis     123590884 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     123590884 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123590884 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123590884 (RAB5B)    04031 GTP-binding proteins [BR:lgf04031]     123590884 (RAB5B) Membrane trafficking [BR:lgf04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     123590884 (RAB5B)  Endosome - Lysosome transport     123590884 (RAB5B) Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123590884 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    123590884 (RAB5B)   Exosomal proteins of colorectal cancer cells    123590884 (RAB5B)   Exosomal proteins of melanoma cells    123590884 (RAB5B) GTP-binding proteins [BR:lgf04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     123590884 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  123590884 NCBI-ProteinID:  XP_045320466 LinkDB All DBs Position B4:83077296..83093592 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagtctggtattacgtttt gtcaaagggcagtttcatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatttgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgggcaaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ctgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system