Leopardus geoffroyi (Geoffroy's cat): 123592775 Help Entry 123592775         CDS       T10761                                  Name (RefSeq) interferon alpha   KO K05414   interferon alpha Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04060   Cytokine-cytokine receptor interaction lgf04151   PI3K-Akt signaling pathway lgf04217   Necroptosis lgf04620   Toll-like receptor signaling pathway lgf04621   NOD-like receptor signaling pathway lgf04622   RIG-I-like receptor signaling pathway lgf04623   Cytosolic DNA-sensing pathway lgf04630   JAK-STAT signaling pathway lgf04650   Natural killer cell mediated cytotoxicity lgf04936   Alcoholic liver disease lgf05152   Tuberculosis lgf05160   Hepatitis C lgf05161   Hepatitis B lgf05162   Measles lgf05163   Human cytomegalovirus infection lgf05164   Influenza A lgf05165   Human papillomavirus infection lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05168   Herpes simplex virus 1 infection lgf05169   Epstein-Barr virus infection lgf05170   Human immunodeficiency virus 1 infection lgf05171   Coronavirus disease lgf05200   Pathways in cancer lgf05320   Autoimmune thyroid disease lgf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123592775    04151 PI3K-Akt signaling pathway     123592775   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123592775  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123592775  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123592775    04621 NOD-like receptor signaling pathway     123592775    04622 RIG-I-like receptor signaling pathway     123592775    04623 Cytosolic DNA-sensing pathway     123592775    04650 Natural killer cell mediated cytotoxicity     123592775  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123592775   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123592775    05161 Hepatitis B     123592775    05160 Hepatitis C     123592775    05171 Coronavirus disease     123592775    05164 Influenza A     123592775    05162 Measles     123592775    05168 Herpes simplex virus 1 infection     123592775    05163 Human cytomegalovirus infection     123592775    05167 Kaposi sarcoma-associated herpesvirus infection     123592775    05169 Epstein-Barr virus infection     123592775    05165 Human papillomavirus infection     123592775   09171 Infectious disease: bacterial    05152 Tuberculosis     123592775   09163 Immune disease    05320 Autoimmune thyroid disease     123592775   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123592775   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123592775  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lgf04052]     123592775 Cytokines and neuropeptides [BR:lgf04052]  Cytokines   Interferons    123592775 SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  123592775 NCBI-ProteinID:  XP_045324082 LinkDB All DBs Position D4:complement(45856796..45857583) Genome browser AA seq 188 aa AA seqDB search MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQPHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVMQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYSSTAL QKRLRSEK NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc tctctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgccagaaggacagaaatgacttcgcc ttcccccaggacgtgtttggtggagaccagccccacaaggcccaagccctctctgtggtg cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcatgcaggaggtgggggagggagaggctcccctcacgaacgaggactcc atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct tgtgcctgggagatcgtccgagcagaaatcatgagatccttgtattcatcaacagccttg cagaaaaggttaaggagcgagaaatga

DBGET integrated database retrieval system