Leopardus geoffroyi (Geoffroy's cat): 123593663 Help Entry 123593663         CDS       T10761                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04010   MAPK signaling pathway lgf04020   Calcium signaling pathway lgf04022   cGMP-PKG signaling pathway lgf04114   Oocyte meiosis lgf04218   Cellular senescence lgf04310   Wnt signaling pathway lgf04360   Axon guidance lgf04370   VEGF signaling pathway lgf04380   Osteoclast differentiation lgf04625   C-type lectin receptor signaling pathway lgf04650   Natural killer cell mediated cytotoxicity lgf04658   Th1 and Th2 cell differentiation lgf04659   Th17 cell differentiation lgf04660   T cell receptor signaling pathway lgf04662   B cell receptor signaling pathway lgf04720   Long-term potentiation lgf04724   Glutamatergic synapse lgf04921   Oxytocin signaling pathway lgf04922   Glucagon signaling pathway lgf04924   Renin secretion lgf05010   Alzheimer disease lgf05014   Amyotrophic lateral sclerosis lgf05020   Prion disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05031   Amphetamine addiction lgf05152   Tuberculosis lgf05163   Human cytomegalovirus infection lgf05166   Human T-cell leukemia virus 1 infection lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05170   Human immunodeficiency virus 1 infection lgf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lgf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123593663 (PPP3R2)    04310 Wnt signaling pathway     123593663 (PPP3R2)    04370 VEGF signaling pathway     123593663 (PPP3R2)    04020 Calcium signaling pathway     123593663 (PPP3R2)    04022 cGMP-PKG signaling pathway     123593663 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     123593663 (PPP3R2)    04218 Cellular senescence     123593663 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123593663 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     123593663 (PPP3R2)    04660 T cell receptor signaling pathway     123593663 (PPP3R2)    04658 Th1 and Th2 cell differentiation     123593663 (PPP3R2)    04659 Th17 cell differentiation     123593663 (PPP3R2)    04662 B cell receptor signaling pathway     123593663 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     123593663 (PPP3R2)    04921 Oxytocin signaling pathway     123593663 (PPP3R2)    04924 Renin secretion     123593663 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     123593663 (PPP3R2)    04720 Long-term potentiation     123593663 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     123593663 (PPP3R2)    04380 Osteoclast differentiation     123593663 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123593663 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123593663 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     123593663 (PPP3R2)    05163 Human cytomegalovirus infection     123593663 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     123593663 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     123593663 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     123593663 (PPP3R2)    05014 Amyotrophic lateral sclerosis     123593663 (PPP3R2)    05020 Prion disease     123593663 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     123593663 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     123593663 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123593663 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lgf01009]     123593663 (PPP3R2) Protein phosphatases and associated proteins [BR:lgf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123593663 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  123593663 NCBI-ProteinID:  XP_045325873 LinkDB All DBs Position D4:complement(63725760..63726846) Genome browser AA seq 170 aa AA seqDB search MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMIV GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagctagttacccgacggagatgtgctcccacttcaaccacgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggactgttcgggctctctgagcgtg gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgat gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctacgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgattgtg gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggtcggaaacctg gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system