Leopardus geoffroyi (Geoffroy's cat): 123595921 Help Entry 123595921         CDS       T10761                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04137   Mitophagy - animal lgf04140   Autophagy - animal lgf04144   Endocytosis lgf04145   Phagosome lgf04148   Efferocytosis lgf05132   Salmonella infection lgf05146   Amoebiasis lgf05152   Tuberculosis Brite KEGG Orthology (KO) [BR:lgf00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123595921    04145 Phagosome     123595921    04140 Autophagy - animal     123595921    04137 Mitophagy - animal     123595921    04148 Efferocytosis     123595921  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123595921    05152 Tuberculosis     123595921   09174 Infectious disease: parasitic    05146 Amoebiasis     123595921  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123595921   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123595921    04031 GTP-binding proteins [BR:lgf04031]     123595921 Membrane trafficking [BR:lgf04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     123595921 Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123595921   Exosomal proteins of other body fluids (saliva and urine)    123595921   Exosomal proteins of colorectal cancer cells    123595921   Exosomal proteins of bladder cancer cells    123595921 GTP-binding proteins [BR:lgf04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     123595921 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA nSTAND3 AAA_16 AAA_5 AAA_24 NB-ARC NTPase_1 AAA_7 PduV-EutP cobW AAA_22 CoaE Septin ATPase_2 NACHT AAA_14 RuvB_N Motif Other DBs NCBI-GeneID:  123595921 NCBI-ProteinID:  XP_045329847 LinkDB All DBs Position B1:complement(152698664..152699573) Genome browser AA seq 205 aa AA seqDB search MTSRKEVLLKVIILGDSGVGKTSLMSQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGGLLQRRRLHLVFDVTAPNTFNTLDSWRDEFLIQAGPWDPENFPFVV LGNKIDLENRLVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIAQNALKQETEMEL YNEFPKPIKLDKNDRAKALAESCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaaggaagtgttgctgaaggttatcatcctgggagattctggagttggt aaaacatcactcatgagccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggacaggaacggttccagtcccttggtggtcttctacagaggcgc agattgcacctggtatttgacgtcactgcccccaacacattcaacacccttgatagctgg agagatgagtttctcatccaggccggtccctgggatcctgaaaacttccccttcgtggtg ttgggaaacaagattgacctggaaaacagactagtggccacaaagcgggcacaggcctgg tgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatcaacgtg gagcaggcattccagacgattgcacagaatgcacttaaacaggaaacagagatggagcta tacaacgaattccccaaacccatcaaactggacaagaacgaccgggccaaggccttggcg gaaagctgcagttgctga

DBGET integrated database retrieval system