Leopardus geoffroyi (Geoffroy's cat): 123597665
Help
Entry
123597665 CDS
T10761
Symbol
NDUFS5
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
KO
K03938
NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
lgf Leopardus geoffroyi (Geoffroy's cat)
Pathway
lgf00190
Oxidative phosphorylation
lgf01100
Metabolic pathways
lgf04714
Thermogenesis
lgf04723
Retrograde endocannabinoid signaling
lgf04932
Non-alcoholic fatty liver disease
lgf05010
Alzheimer disease
lgf05012
Parkinson disease
lgf05014
Amyotrophic lateral sclerosis
lgf05016
Huntington disease
lgf05020
Prion disease
lgf05022
Pathways of neurodegeneration - multiple diseases
lgf05208
Chemical carcinogenesis - reactive oxygen species
lgf05415
Diabetic cardiomyopathy
Module
lgf_M00143
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:
lgf00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
123597665 (NDUFS5)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
123597665 (NDUFS5)
09159 Environmental adaptation
04714 Thermogenesis
123597665 (NDUFS5)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
123597665 (NDUFS5)
09164 Neurodegenerative disease
05010 Alzheimer disease
123597665 (NDUFS5)
05012 Parkinson disease
123597665 (NDUFS5)
05014 Amyotrophic lateral sclerosis
123597665 (NDUFS5)
05016 Huntington disease
123597665 (NDUFS5)
05020 Prion disease
123597665 (NDUFS5)
05022 Pathways of neurodegeneration - multiple diseases
123597665 (NDUFS5)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
123597665 (NDUFS5)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
123597665 (NDUFS5)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ndufs5
Cmc1
Motif
Other DBs
NCBI-GeneID:
123597665
NCBI-ProteinID:
XP_045332772
LinkDB
All DBs
Position
C1:30217964..30223641
Genome browser
AA seq
106 aa
AA seq
DB search
MPFFDVQKRLGLNLDQWMTIQSAEQPHKIPGRCHAFEKEWIECAHGIGGIRAEKECKIEY
DDFVECLLRQKTMKRLSDIRRQRDKLIKEGKYTPPPHHLGKEDPRP
NT seq
321 nt
NT seq
+upstream
nt +downstream
nt
atgcctttctttgatgtgcagaaaaggctgggccttaacttagatcagtggatgacaatc
caaagtgctgagcagcctcacaagattccaggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcgcatggaattggtggtatccgtgcagagaaagagtgcaagatagaatat
gatgatttcgtagaatgtctgcttcggcagaaaacgatgaagcgtctgagtgacatcagg
aggcagcgggataaactgataaaggaagggaagtacacacccccgcctcaccacttgggc
aaggaggaccctaggccctga
DBGET
integrated database retrieval system