Leopardus geoffroyi (Geoffroy's cat): 123598503 Help Entry 123598503         CDS       T10761                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf01521   EGFR tyrosine kinase inhibitor resistance lgf01522   Endocrine resistance lgf04010   MAPK signaling pathway lgf04012   ErbB signaling pathway lgf04014   Ras signaling pathway lgf04015   Rap1 signaling pathway lgf04062   Chemokine signaling pathway lgf04068   FoxO signaling pathway lgf04071   Sphingolipid signaling pathway lgf04072   Phospholipase D signaling pathway lgf04137   Mitophagy - animal lgf04140   Autophagy - animal lgf04150   mTOR signaling pathway lgf04151   PI3K-Akt signaling pathway lgf04210   Apoptosis lgf04211   Longevity regulating pathway lgf04213   Longevity regulating pathway - multiple species lgf04218   Cellular senescence lgf04360   Axon guidance lgf04370   VEGF signaling pathway lgf04371   Apelin signaling pathway lgf04540   Gap junction lgf04550   Signaling pathways regulating pluripotency of stem cells lgf04625   C-type lectin receptor signaling pathway lgf04650   Natural killer cell mediated cytotoxicity lgf04660   T cell receptor signaling pathway lgf04662   B cell receptor signaling pathway lgf04664   Fc epsilon RI signaling pathway lgf04714   Thermogenesis lgf04720   Long-term potentiation lgf04722   Neurotrophin signaling pathway lgf04725   Cholinergic synapse lgf04726   Serotonergic synapse lgf04730   Long-term depression lgf04810   Regulation of actin cytoskeleton lgf04910   Insulin signaling pathway lgf04912   GnRH signaling pathway lgf04915   Estrogen signaling pathway lgf04916   Melanogenesis lgf04917   Prolactin signaling pathway lgf04919   Thyroid hormone signaling pathway lgf04921   Oxytocin signaling pathway lgf04926   Relaxin signaling pathway lgf04929   GnRH secretion lgf04933   AGE-RAGE signaling pathway in diabetic complications lgf04935   Growth hormone synthesis, secretion and action lgf05010   Alzheimer disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05034   Alcoholism lgf05160   Hepatitis C lgf05161   Hepatitis B lgf05163   Human cytomegalovirus infection lgf05165   Human papillomavirus infection lgf05166   Human T-cell leukemia virus 1 infection lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05170   Human immunodeficiency virus 1 infection lgf05200   Pathways in cancer lgf05203   Viral carcinogenesis lgf05205   Proteoglycans in cancer lgf05206   MicroRNAs in cancer lgf05207   Chemical carcinogenesis - receptor activation lgf05208   Chemical carcinogenesis - reactive oxygen species lgf05210   Colorectal cancer lgf05211   Renal cell carcinoma lgf05213   Endometrial cancer lgf05214   Glioma lgf05215   Prostate cancer lgf05216   Thyroid cancer lgf05218   Melanoma lgf05219   Bladder cancer lgf05220   Chronic myeloid leukemia lgf05221   Acute myeloid leukemia lgf05223   Non-small cell lung cancer lgf05224   Breast cancer lgf05225   Hepatocellular carcinoma lgf05226   Gastric cancer lgf05230   Central carbon metabolism in cancer lgf05231   Choline metabolism in cancer lgf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lgf05417   Lipid and atherosclerosis Brite Membrane trafficking [BR:lgf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     123598503 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     123598503 (NRAS) Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123598503 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    123598503 (NRAS)   Exosomal proteins of breast cancer cells    123598503 (NRAS)   Exosomal proteins of colorectal cancer cells    123598503 (NRAS) GTP-binding proteins [BR:lgf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     123598503 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  123598503 NCBI-ProteinID:  XP_045334707 LinkDB All DBs Position C1:complement(98046624..98056971) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system