Leopardus geoffroyi (Geoffroy's cat): 123598628 Help Entry 123598628         CDS       T10761                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04613   Neutrophil extracellular trap formation lgf05034   Alcoholism lgf05203   Viral carcinogenesis lgf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lgf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123598628  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123598628   09163 Immune disease    05322 Systemic lupus erythematosus     123598628   09165 Substance dependence    05034 Alcoholism     123598628  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgf03036]     123598628   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123598628 Chromosome and associated proteins [BR:lgf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123598628 Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123598628 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  123598628 NCBI-ProteinID:  XP_045334932 LinkDB All DBs Position C1:complement(104824927..104826412) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAAKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccggcaaagtccgcccccgcggccaagaagggctcgaagaaggcggtcacc aaagcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system