Leopardus geoffroyi (Geoffroy's cat): 123598716 Help Entry 123598716         CDS       T10761                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04382   Cornified envelope formation lgf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lgf00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     123598716 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123598716 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123598716 (S100A10) Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of microglial cells    123598716 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  123598716 NCBI-ProteinID:  XP_045335207 LinkDB All DBs Position C1:complement(106628800..106639306) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaacgatgatgttcacgttccacaagtttgct ggggacaaaggctacctaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaagataatgaaggacctagac cagtgccgggacggcagagtgggtttccagagcttcttttcgctgattgctgggctcacc atcgcatgcaatgactattttgtagttcacatgaagcagaaaggaaagaagtag

DBGET integrated database retrieval system