Leopardus geoffroyi (Geoffroy's cat): 123599039 Help Entry 123599039         CDS       T10761                                  Name (RefSeq) cofilin-2-like   KO K05765   cofilin Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04360   Axon guidance lgf04666   Fc gamma R-mediated phagocytosis lgf04810   Regulation of actin cytoskeleton lgf05133   Pertussis lgf05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:lgf00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     123599039  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     123599039   09158 Development and regeneration    04360 Axon guidance     123599039  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123599039   09171 Infectious disease: bacterial    05133 Pertussis     123599039  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123599039   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lgf04812]     123599039    04147 Exosome [BR:lgf04147]     123599039 Membrane trafficking [BR:lgf04131]  Others   Actin-binding proteins    Others     123599039 Cytoskeleton proteins [BR:lgf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      123599039 Exosome [BR:lgf04147]  Exosomal proteins   Proteins found in most exosomes    123599039 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  123599039 NCBI-ProteinID:  XP_045336067 LinkDB All DBs Position C1:complement(158553913..158555333) Genome browser AA seq 156 aa AA seqDB search MASGVTVNDQVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTPFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWGPESAPLKSKMIYASS KDAVKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGN NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatcaagtcatcaaagtttttaatgatatgaaagta agaaaatcttctacacaagaggagatcaaaaaaagaaagaaagccgttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacaccttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacctacgaaacaaaagagtctaagaaagaagacctagta tttatattctggggtcctgagagtgcacctttaaaaagcaagatgatttatgctagctct aaagatgccgttaaaaagaaatttacaggtattaaacatgaatggcaagtaaatggcttg gatgatataaaggaccgttcaacacttggagagaaattgggaggcaactag

DBGET integrated database retrieval system