Leopardus geoffroyi (Geoffroy's cat): 123599782 Help Entry 123599782         CDS       T10761                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04014   Ras signaling pathway lgf04015   Rap1 signaling pathway lgf04020   Calcium signaling pathway lgf04022   cGMP-PKG signaling pathway lgf04024   cAMP signaling pathway lgf04070   Phosphatidylinositol signaling system lgf04114   Oocyte meiosis lgf04218   Cellular senescence lgf04261   Adrenergic signaling in cardiomyocytes lgf04270   Vascular smooth muscle contraction lgf04371   Apelin signaling pathway lgf04625   C-type lectin receptor signaling pathway lgf04713   Circadian entrainment lgf04720   Long-term potentiation lgf04722   Neurotrophin signaling pathway lgf04728   Dopaminergic synapse lgf04740   Olfactory transduction lgf04744   Phototransduction lgf04750   Inflammatory mediator regulation of TRP channels lgf04910   Insulin signaling pathway lgf04912   GnRH signaling pathway lgf04915   Estrogen signaling pathway lgf04916   Melanogenesis lgf04921   Oxytocin signaling pathway lgf04922   Glucagon signaling pathway lgf04924   Renin secretion lgf04925   Aldosterone synthesis and secretion lgf04970   Salivary secretion lgf04971   Gastric acid secretion lgf05010   Alzheimer disease lgf05012   Parkinson disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05031   Amphetamine addiction lgf05034   Alcoholism lgf05133   Pertussis lgf05152   Tuberculosis lgf05163   Human cytomegalovirus infection lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05170   Human immunodeficiency virus 1 infection lgf05200   Pathways in cancer lgf05214   Glioma lgf05417   Lipid and atherosclerosis lgf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123599782 (CALML6)    04015 Rap1 signaling pathway     123599782 (CALML6)    04371 Apelin signaling pathway     123599782 (CALML6)    04020 Calcium signaling pathway     123599782 (CALML6)    04070 Phosphatidylinositol signaling system     123599782 (CALML6)    04024 cAMP signaling pathway     123599782 (CALML6)    04022 cGMP-PKG signaling pathway     123599782 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     123599782 (CALML6)    04218 Cellular senescence     123599782 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123599782 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     123599782 (CALML6)    04922 Glucagon signaling pathway     123599782 (CALML6)    04912 GnRH signaling pathway     123599782 (CALML6)    04915 Estrogen signaling pathway     123599782 (CALML6)    04921 Oxytocin signaling pathway     123599782 (CALML6)    04916 Melanogenesis     123599782 (CALML6)    04924 Renin secretion     123599782 (CALML6)    04925 Aldosterone synthesis and secretion     123599782 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     123599782 (CALML6)    04270 Vascular smooth muscle contraction     123599782 (CALML6)   09154 Digestive system    04970 Salivary secretion     123599782 (CALML6)    04971 Gastric acid secretion     123599782 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     123599782 (CALML6)    04720 Long-term potentiation     123599782 (CALML6)    04722 Neurotrophin signaling pathway     123599782 (CALML6)   09157 Sensory system    04744 Phototransduction     123599782 (CALML6)    04740 Olfactory transduction     123599782 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     123599782 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     123599782 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123599782 (CALML6)   09162 Cancer: specific types    05214 Glioma     123599782 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123599782 (CALML6)    05163 Human cytomegalovirus infection     123599782 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     123599782 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     123599782 (CALML6)    05152 Tuberculosis     123599782 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     123599782 (CALML6)    05012 Parkinson disease     123599782 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     123599782 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     123599782 (CALML6)    05034 Alcoholism     123599782 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123599782 (CALML6)    05418 Fluid shear stress and atherosclerosis     123599782 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lgf01009]     123599782 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123599782 (CALML6)    03036 Chromosome and associated proteins [BR:lgf03036]     123599782 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123599782 (CALML6) Protein phosphatases and associated proteins [BR:lgf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123599782 (CALML6) Membrane trafficking [BR:lgf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     123599782 (CALML6) Chromosome and associated proteins [BR:lgf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      123599782 (CALML6) Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    123599782 (CALML6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  123599782 NCBI-ProteinID:  XP_045338022 LinkDB All DBs Position C1:814256..817093 Genome browser AA seq 230 aa AA seqDB search HLRGKGWESLSSSSPSLEPAGRSKQPGQRRATPPDLGPAFAAPLSPRPAGLVPAGAIPSV STNLAASAAGLGLGGTERLTAEQIKEYKGVFEMFDEEGNGEVKTAELERLMSLLGINPTK SELASMAKDVDRDNKGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKEGKGYIDWNT LKYVLMNAGEPLNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 693 nt NT seq  +upstreamnt  +downstreamnt catcttcgagggaaggggtgggaaagtctttcctcctcatcaccaagcctggagccagcg ggccggagcaagcagccagggcagaggcgggccacccccccagacctggggccagctttt gctgcgcccctgtccccgaggcccgctggtcttgtgcccgccggagccatcccgtccgtc agcacaaatcttgcggcctcagcagctggcctgggcctcggcgggacggagcgcctgacg gccgagcagatcaaggagtacaagggggtctttgagatgttcgacgaggagggcaacggg gaggtgaagacagcggagctggagcggctcatgagcctgctgggcatcaaccccaccaag agcgagctggcctccatggccaaggacgtggacagagacaacaaagggttcttcaactgt gacagcttcctggccctgatggggatttactgggagaaggcccagaaccaggagggcgag ctgagggcagccttccgtgtcttcgacaaggagggcaagggctacatcgactggaacacg cttaagtacgtgctcatgaatgcaggtgagcccctcaatgaggtagaggccgagcagatg atgaaggaggctgacaaggacggagacggaaccatcgactatgaggagtttgtggccatg atgaccggagagtccttcaagctggtccagtag

DBGET integrated database retrieval system