Leopardus geoffroyi (Geoffroy's cat): 123603723 Help Entry 123603723         CDS       T10761                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04014   Ras signaling pathway lgf04137   Mitophagy - animal lgf04144   Endocytosis lgf04145   Phagosome lgf04148   Efferocytosis lgf04962   Vasopressin-regulated water reabsorption lgf05132   Salmonella infection lgf05146   Amoebiasis lgf05152   Tuberculosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123603723 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123603723 (RAB5C)    04145 Phagosome     123603723 (RAB5C)    04137 Mitophagy - animal     123603723 (RAB5C)    04148 Efferocytosis     123603723 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     123603723 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123603723 (RAB5C)    05152 Tuberculosis     123603723 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     123603723 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123603723 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123603723 (RAB5C)    04031 GTP-binding proteins [BR:lgf04031]     123603723 (RAB5C) Membrane trafficking [BR:lgf04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     123603723 (RAB5C)  Endosome - Lysosome transport     123603723 (RAB5C) Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123603723 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    123603723 (RAB5C)   Exosomal proteins of colorectal cancer cells    123603723 (RAB5C)   Exosomal proteins of bladder cancer cells    123603723 (RAB5C) GTP-binding proteins [BR:lgf04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     123603723 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  123603723 NCBI-ProteinID:  XP_045344852 LinkDB All DBs Position E1:complement(40722155..40745885) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaacggaccagccgctgggaacaagatctgt cagtttaagctggtcctgctcggggagtctgcagtgggcaaatccagcctcgtgctccgc tttgtcaagggacagttccatgagtaccaggagagcaccattggagcggccttcctcaca cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaagctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggctagccccaacatcgtcatcgcacttgcagggaacaaggcggacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcggaagacaacagtctgctgttc atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcagctggtgctccaggccggaaccgaggcgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system