Leopardus geoffroyi (Geoffroy's cat): 123604455 Help Entry 123604455         CDS       T10761                                  Name (RefSeq) C-C motif chemokine 23-like   KO K05511   C-C motif chemokine 15/23 Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04060   Cytokine-cytokine receptor interaction lgf04061   Viral protein interaction with cytokine and cytokine receptor lgf04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123604455    04061 Viral protein interaction with cytokine and cytokine receptor     123604455  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     123604455  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lgf04052]     123604455 Cytokines and neuropeptides [BR:lgf04052]  Cytokines   Chemokines    123604455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  123604455 NCBI-ProteinID:  XP_045346503 LinkDB All DBs Position E1:complement(23133204..23137279) Genome browser AA seq 107 aa AA seqDB search MKVFAAALPFLIVATAFGAQVQALHEPMVAIRPHETSIHLQGFHRPSDCCTQYTPRKIRC GFMEDYYETSSGCSQPGVIFLTKKGQRVCANPFDLGVQNCVRSLKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcttcgcagctgccctccccttcctcattgttgctactgcctttggagcccag gtccaggcccttcatgaacccatggtggcaatacgtccgcatgaaacctcgatacatctg caaggctttcaccgtccctctgactgctgcacccagtacactccacggaaaatccgatgt ggattcatggaagattactatgaaacaagcagcgggtgctcccagccaggtgtcatcttc ctcaccaagaaggggcagcgtgtctgtgccaacccctttgatttgggagttcagaattgc gtgaggtccctgaagtcgaactaa

DBGET integrated database retrieval system