Leopardus geoffroyi (Geoffroy's cat): 123604666 Help Entry 123604666         CDS       T10761                                  Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04060   Cytokine-cytokine receptor interaction lgf04061   Viral protein interaction with cytokine and cytokine receptor lgf04062   Chemokine signaling pathway lgf04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     123604666   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123604666    04061 Viral protein interaction with cytokine and cytokine receptor     123604666  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     123604666  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lgf04052]     123604666    00536 Glycosaminoglycan binding proteins [BR:lgf00536]     123604666 Cytokines and neuropeptides [BR:lgf04052]  Cytokines   Chemokines    123604666 Glycosaminoglycan binding proteins [BR:lgf00536]  Heparan sulfate / Heparin   Chemokines    123604666 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123604666 NCBI-ProteinID:  XP_045346952 LinkDB All DBs Position E1:21956894..21958567 Genome browser AA seq 98 aa AA seqDB search MRVSAALLCLLLAAAAFSLQAFAQPGAFSALFPCCFTFNNKKFPLPKLTTYRITSSHCPQ RAVIFKTKLAKEICADPKEKWVQEYVKQLSQKSHALKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagggtctccgcagcgcttctgtgcctgctgctggcagctgccgccttcagcctccag gcgttcgcccagccaggtgcattcagtgccctgttcccttgctgtttcacgtttaacaat aagaagttccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag agagctgtcatcttcaagacgaagctggccaaggagatctgtgctgacccgaaggagaaa tgggtccaggagtatgtgaaacagctcagtcaaaaatctcatgccctgaagccttga

DBGET integrated database retrieval system