Leopardus geoffroyi (Geoffroy's cat): 123604684 Help Entry 123604684         CDS       T10761                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04081   Hormone signaling lgf04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     123604684 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     123604684 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lgf04052]     123604684 (GAST) Cytokines and neuropeptides [BR:lgf04052]  Neuropeptides   GPCR binding    123604684 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  123604684 NCBI-ProteinID:  XP_045346965 LinkDB All DBs Position E1:40419600..40422804 Genome browser AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGASRGLEPHWPNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccagtagg ggcctggaaccacattggccgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system