Leopardus geoffroyi (Geoffroy's cat): 123606572 Help Entry 123606572         CDS       T10761                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf00190   Oxidative phosphorylation lgf01100   Metabolic pathways lgf01524   Platinum drug resistance lgf04115   p53 signaling pathway lgf04210   Apoptosis lgf04215   Apoptosis - multiple species lgf04932   Non-alcoholic fatty liver disease lgf05010   Alzheimer disease lgf05012   Parkinson disease lgf05014   Amyotrophic lateral sclerosis lgf05016   Huntington disease lgf05017   Spinocerebellar ataxia lgf05020   Prion disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05132   Salmonella infection lgf05134   Legionellosis lgf05145   Toxoplasmosis lgf05152   Tuberculosis lgf05160   Hepatitis C lgf05161   Hepatitis B lgf05162   Measles lgf05163   Human cytomegalovirus infection lgf05164   Influenza A lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05168   Herpes simplex virus 1 infection lgf05169   Epstein-Barr virus infection lgf05170   Human immunodeficiency virus 1 infection lgf05200   Pathways in cancer lgf05210   Colorectal cancer lgf05222   Small cell lung cancer lgf05416   Viral myocarditis lgf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lgf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     123606572  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     123606572    04215 Apoptosis - multiple species     123606572    04115 p53 signaling pathway     123606572  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123606572   09162 Cancer: specific types    05210 Colorectal cancer     123606572    05222 Small cell lung cancer     123606572   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123606572    05161 Hepatitis B     123606572    05160 Hepatitis C     123606572    05164 Influenza A     123606572    05162 Measles     123606572    05168 Herpes simplex virus 1 infection     123606572    05163 Human cytomegalovirus infection     123606572    05167 Kaposi sarcoma-associated herpesvirus infection     123606572    05169 Epstein-Barr virus infection     123606572   09171 Infectious disease: bacterial    05132 Salmonella infection     123606572    05134 Legionellosis     123606572    05152 Tuberculosis     123606572   09174 Infectious disease: parasitic    05145 Toxoplasmosis     123606572   09164 Neurodegenerative disease    05010 Alzheimer disease     123606572    05012 Parkinson disease     123606572    05014 Amyotrophic lateral sclerosis     123606572    05016 Huntington disease     123606572    05017 Spinocerebellar ataxia     123606572    05020 Prion disease     123606572    05022 Pathways of neurodegeneration - multiple diseases     123606572   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123606572    05416 Viral myocarditis     123606572   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     123606572   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     123606572 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  123606572 NCBI-ProteinID:  XP_045351073 LinkDB All DBs Position A2:complement(117445699..117448174) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa aaagctactaaggagtaa

DBGET integrated database retrieval system