Leopardus geoffroyi (Geoffroy's cat): 123609507 Help Entry 123609507         CDS       T10761                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04613   Neutrophil extracellular trap formation lgf05034   Alcoholism lgf05203   Viral carcinogenesis lgf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lgf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123609507  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123609507   09163 Immune disease    05322 Systemic lupus erythematosus     123609507   09165 Substance dependence    05034 Alcoholism     123609507  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgf03036]     123609507 Chromosome and associated proteins [BR:lgf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123609507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  123609507 NCBI-ProteinID:  XP_045356543 LinkDB All DBs Position B2:2830633..2831204 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggccggggcaaaggcgggaagggcttgggcaaagggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc tttgggggctga

DBGET integrated database retrieval system