Leopardus geoffroyi (Geoffroy's cat): 123610961 Help Entry 123610961         CDS       T10761                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Brite KEGG Orthology (KO) [BR:lgf00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:lgf01002]     123610961 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgf04147]     123610961 (CSTA) Peptidases and inhibitors [BR:lgf01002]  Peptidase inhibitors   Family I25: cystatin family    123610961 (CSTA) Exosome [BR:lgf04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    123610961 (CSTA) SSDB OrthologParalogGFIT Motif Pfam:  Cystatin DUF6138 SQAPI Dynein_light DAHP_snth_FXD BioS Motif Other DBs NCBI-GeneID:  123610961 NCBI-ProteinID:  XP_045358202 LinkDB All DBs Position C2:68070951..68082075 Genome browser AA seq 98 aa AA seqDB search MIPGGLSEAKPATPEIQEIANEVKHQLEEKTNETYQKFEAIEYKTQVVAGINYYIKVQVG DNRYIHIKVFKGLPVQDSSLTLTGYQTGKSEDDELTGF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatacctggaggcttaagtgaagccaaacctgccactccagaaatccaagagattgct aacgaggttaaacatcagcttgaagaaaaaacaaatgagacttaccaaaaatttgaagct atagagtacaaaactcaagtggttgccggaataaattactacattaaggtgcaagtaggt gataatagatatattcacattaaagtattcaaaggtcttccagtacaagattcatctttg acacttactggttaccagactggcaaaagtgaggacgatgagctgacaggcttttag

DBGET integrated database retrieval system