Leopardus geoffroyi (Geoffroy's cat): 123611408 Help Entry 123611408         CDS       T10761                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04015   Rap1 signaling pathway lgf04810   Regulation of actin cytoskeleton lgf05014   Amyotrophic lateral sclerosis lgf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     123611408 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     123611408 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123611408 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     123611408 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123611408 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lgf04812]     123611408 (PFN2)    04147 Exosome [BR:lgf04147]     123611408 (PFN2) Membrane trafficking [BR:lgf04131]  Others   Actin-binding proteins    Others     123611408 (PFN2) Cytoskeleton proteins [BR:lgf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      123611408 (PFN2) Exosome [BR:lgf04147]  Exosomal proteins   Proteins found in most exosomes    123611408 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  123611408 NCBI-ProteinID:  XP_045359255 LinkDB All DBs Position C2:114500452..114603741 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system