Lottia gigantea (owl limpet): LOTGIDRAFT_106494 Help Entry LOTGIDRAFT_106494 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K08336   ubiquitin-like protein ATG12 Organism lgi  Lottia gigantea (owl limpet) Pathway lgi04068   FoxO signaling pathway lgi04136   Autophagy - other lgi04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:lgi00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     LOTGIDRAFT_106494  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     LOTGIDRAFT_106494    04136 Autophagy - other     LOTGIDRAFT_106494  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgi04131]     LOTGIDRAFT_106494    04121 Ubiquitin system [BR:lgi04121]     LOTGIDRAFT_106494    03029 Mitochondrial biogenesis [BR:lgi03029]     LOTGIDRAFT_106494 Membrane trafficking [BR:lgi04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     LOTGIDRAFT_106494 Ubiquitin system [BR:lgi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    LOTGIDRAFT_106494 Mitochondrial biogenesis [BR:lgi03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     LOTGIDRAFT_106494 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  20230119 NCBI-ProteinID:  XP_009060176 JGI:  106494 UniProt:  V4A2G8 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search VDVLLKPAGDAPIMKKKKWAVDRNKAVGWVSEFIKRYLKFTATDSLFLYVNQSFSPSPDT EIGVLFDCFGSDGKLVLHYCKTQAWG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gttgatgtgttattaaaaccagcaggagatgcacccattatgaagaaaaagaaatgggct gtagaccgaaacaaagctgtaggatgggtcagtgaatttatcaaaagataccttaaattt actgcaacagattctttgtttttatatgttaatcagtcattttcaccttcaccagataca gaaataggagttttatttgattgttttggaagtgatggaaagctagttctacattactgt aaaacacaagcctggggatga

DBGET integrated database retrieval system